DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and Pik3r3

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_071549.2 Gene:Pik3r3 / 60664 RGDID:621042 Length:461 Species:Rattus norvegicus


Alignment Length:312 Identity:69/312 - (22%)
Similarity:108/312 - (34%) Gaps:115/312 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   863 EVEQPAGSAADEQFCNCPPAGQKPVKPSVQISGHKDHPFESSSGELDENSDRDIDNDEEEEDSAS 927
            |::.||          .||...|||..:| .:|.||                             
  Rat    31 EMDPPA----------LPPKPPKPVTSAV-TNGMKD----------------------------- 55

  Fly   928 DDVLSMKDHCYCVPSLAASISLSTNRPLYEEEWFHGVLPREEVVRLLNN--DGDFLVRETIRNEE 990
                     |:        :||.      :.||:.|.:.||||...|.:  ||.||||:.....:
  Rat    56 ---------CF--------VSLQ------DAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQ 97

  Fly   991 SQIVLSVCWNGHKHFIVQTTGEGNFRFEGP-PFASIQELIMHQYHSEL-PVTVKSGAILRRPVCR 1053
            ....|::...|:...|.....:|.:.|..| .|.|:.|||.|.:|..| ....|....|..||.|
  Rat    98 GDYTLTLRKGGNNKLIKIYHRDGKYGFSEPLTFNSVVELINHYHHESLAQYNPKLDVKLMYPVSR 162

  Fly  1054 -ERWELSNDDVVLLERIGRG--NFGDVYKAK-------------------LKSTKLDVAVKTCRM 1096
             ::.:|..:|.:  :.:|:.  .|...|:.|                   :|.|.::...:|.::
  Rat   163 YQQDQLVKEDNI--DAVGKNLQEFHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKI 225

  Fly  1097 ------TLPDEQK---RKFLQEG------RILKQYD---------HPNIVKL 1124
                  |.....|   .:|.:||      ||:..||         |.:.|:|
  Rat   226 FEEQCHTQEQHSKDYIERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKVRL 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 28/89 (31%)
TyrKc 1063..1311 CDD:197581 19/107 (18%)
PTKc_Fes_like 1067..1315 CDD:270637 19/103 (18%)
Pik3r3NP_071549.2 SH2_nSH2_p85_like 59..167 CDD:198195 35/113 (31%)
iSH2_PI3K_IA_R 172..332 CDD:355389 20/108 (19%)
SH2_cSH2_p85_like 351..454 CDD:198184
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.