DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and Matk

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:XP_038935769.1 Gene:Matk / 60450 RGDID:69058 Length:496 Species:Rattus norvegicus


Alignment Length:422 Identity:136/422 - (32%)
Similarity:198/422 - (46%) Gaps:86/422 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   948 SLSTNRPLYEEEWFHGVLPREEVVRLLN--NDGDFLVRETIRNEESQIVLSVCWNG--------H 1002
            :|||:..|....||||.:..:|.::.|.  .||.|||||:.|: ....||.|.:..        |
  Rat    69 ALSTDPKLSLMPWFHGKISGQEAIQQLQPPEDGLFLVRESARH-PGDYVLCVSFGRDVIHYRVLH 132

  Fly  1003 K--HFIVQTTGEGNFRFEGPPFASIQELIMHQYHSELPVTVKSGAILRRPVCRER---------- 1055
            :  |..:.         |...|.::.:::.|       .|...|||..:.|..:|          
  Rat   133 RDGHLTID---------EAVCFCNLMDMVEH-------YTRDKGAICTKLVKPKRKQGAKSAEEE 181

  Fly  1056 -----WELSNDDVVLLERIGRGNFGDVYKAKLKSTKLDVAVKTCRMTLPDEQKRKFLQEGRILKQ 1115
                 |.|....:.|..:||.|.||.|.:.:....|  ||||..:.   |...:.||.|..::.:
  Rat   182 LAKAGWLLDLQHLTLGAQIGEGEFGAVLQGEYLGQK--VAVKNIKC---DVTAQAFLDETAVMTK 241

  Fly  1116 YDHPNIVKLIGICVQKQPIMIVMELVLGGSLLTYLRKNSNGL-TTRQQMGMCRDAAAGMRYLESK 1179
            ..|.|:|:|:|: :....:.||||.|..|:|:.:||.....| :|.|.:......|.||.|||||
  Rat   242 LQHRNLVRLLGV-ILHHGLYIVMEHVSKGNLVNFLRTRGRALVSTSQLLQFALHVAEGMEYLESK 305

  Fly  1180 NCIHRDLAARNCLVDLEHSVKISDFGMSREEEEYIVSDGM--KQIPVKWTAPEALNFGKYTSLCD 1242
            ..:||||||||.||..:...|:||||:::.|    :..|:  .::||||||||||..|:::|..|
  Rat   306 KLVHRDLAARNILVSEDLVAKVSDFGLAKAE----LRKGLDSSRLPVKWTAPEALKNGRFSSKSD 366

  Fly  1243 VWSYGILMWEIFSKGDTPYSGMTNS-----------------------------RARERIDTGYR 1278
            |||:|:|:||:||.|..||..|.:|                             ...|.::.|||
  Rat   367 VWSFGVLLWEVFSYGRAPYPKMVSSTPGRAACASRVTDCPHPCYPLPPYLQSLKEVSEAVEKGYR 431

  Fly  1279 MPTPKSTPEEMYRLMLQCWAADAESRPHFDEI 1310
            |..|.|.|..::.||..||.|:...||.|.:|
  Rat   432 MEPPDSCPGPVHTLMGSCWEAEPSRRPPFRKI 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 23/97 (24%)
TyrKc 1063..1311 CDD:197581 102/280 (36%)
PTKc_Fes_like 1067..1315 CDD:270637 101/276 (37%)
MatkXP_038935769.1 SH3 9..67 CDD:418401
SH2_csk_like 77..174 CDD:198190 28/113 (25%)
PKc_like 187..470 CDD:419665 104/287 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100013
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.