DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and fgfr3

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:XP_021336328.1 Gene:fgfr3 / 58129 ZFINID:ZDB-GENE-000816-1 Length:821 Species:Danio rerio


Alignment Length:402 Identity:119/402 - (29%)
Similarity:174/402 - (43%) Gaps:98/402 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   942 SLAASISLSTNRPLYEEEWFHGVLPREEVVRLLNNDGDFLVRETIRNEESQIVLSVCWNGHKHFI 1006
            ||.::.|:::|.||.            .:.||.::|                             
Zfish   433 SLESNSSMNSNTPLV------------RIARLSSSD----------------------------- 456

  Fly  1007 VQTTGEGNFRFEGPPFASIQELIMHQYHSELPVTVKSGAILRRPVCRERWELSNDDVVLLERIGR 1071
                        ||...::.||       |||...|             ||.:...:.|.:.:|.
Zfish   457 ------------GPMLPNVSEL-------ELPSDPK-------------WEFTRTKLTLGKPLGE 489

  Fly  1072 GNFGDVYKA------KLKSTK-LDVAVKTCRMTLPDEQKRKFLQEGRILKQY-DHPNIVKLIGIC 1128
            |.||.|..|      |.|..| |.||||..:....|:.....:.|..::|.. .|.||:.|:|.|
Zfish   490 GCFGQVVMAEAIGIDKEKPNKPLTVAVKMLKDDGTDKDLSDLVSEMEMMKMIGKHKNIINLLGAC 554

  Fly  1129 VQKQPIMIVMELVLGGSLLTYLRKN---------------SNGLTTRQQMGMCRDAAAGMRYLES 1178
            .|..|:.:::|....|:|..|||..               :..||.:..:......|.||.||.|
Zfish   555 TQDGPLYVLVEYASKGNLREYLRARRPPGMDYSFDTCKIPNETLTFKDLVSCAYQVARGMEYLAS 619

  Fly  1179 KNCIHRDLAARNCLVDLEHSVKISDFGMSREEE--EYIVSDGMKQIPVKWTAPEALNFGKYTSLC 1241
            |.||||||||||.||..::.:||:|||::|:..  :|.......::||||.|||||....||...
Zfish   620 KKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQS 684

  Fly  1242 DVWSYGILMWEIFSKGDTPYSGMTNSRARERIDTGYRMPTPKSTPEEMYRLMLQCWAADAESRPH 1306
            ||||||:|:||||:.|.:||.|:......:.:..|:||..|.:...|:|.:|.:||.|....||.
Zfish   685 DVWSYGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHELYMIMRECWHAVPSQRPT 749

  Fly  1307 FDEIYNVVDALI 1318
            |.::....|.::
Zfish   750 FRQLVEDHDRVL 761

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 11/85 (13%)
TyrKc 1063..1311 CDD:197581 99/272 (36%)
PTKc_Fes_like 1067..1315 CDD:270637 98/272 (36%)
fgfr3XP_021336328.1 IGc2 67..121 CDD:197706
Ig2_FGFR 173..257 CDD:143265
Ig3_FGFR-2 280..369 CDD:143266
PTKc_FGFR3 468..801 CDD:173652 105/307 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100013
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.