DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and PTK2

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:XP_024302967.1 Gene:PTK2 / 5747 HGNCID:9611 Length:1119 Species:Homo sapiens


Alignment Length:261 Identity:106/261 - (40%)
Similarity:154/261 - (59%) Gaps:9/261 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly  1056 WELSNDDVVLLERIGRGNFGDVYKAKLKSTK---LDVAVKTCRMTLPDEQKRKFLQEGRILKQYD 1117
            :|:..:.:.|...||.|.||||::....|.:   |.||:|||:....|..:.|||||...::|:|
Human   479 YEIQRERIELGRCIGEGQFGDVHQGIYMSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFD 543

  Fly  1118 HPNIVKLIGICVQKQPIMIVMELVLGGSLLTYLRKNSNGLTTRQQMGMCRDAAAGMRYLESKNCI 1182
            ||:||||||: :.:.|:.|:|||...|.|.::|:.....|.....:......:..:.|||||..:
Human   544 HPHIVKLIGV-ITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFV 607

  Fly  1183 HRDLAARNCLVDLEHSVKISDFGMSREEEE---YIVSDGMKQIPVKWTAPEALNFGKYTSLCDVW 1244
            |||:||||.||.....||:.|||:||..|:   |..|.|  ::|:||.|||::||.::||..|||
Human   608 HRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKG--KLPIKWMAPESINFRRFTSASDVW 670

  Fly  1245 SYGILMWEIFSKGDTPYSGMTNSRARERIDTGYRMPTPKSTPEEMYRLMLQCWAADAESRPHFDE 1309
            .:|:.||||...|..|:.|:.|:....||:.|.|:|.|.:.|..:|.||.:|||.|...||.|.|
Human   671 MFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTE 735

  Fly  1310 I 1310
            :
Human   736 L 736

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581 105/254 (41%)
PTKc_Fes_like 1067..1315 CDD:270637 104/250 (42%)
PTK2XP_024302967.1 B41 87..309 CDD:214604
FERM_C_FAK1 305..415 CDD:270011
PTKc_FAK 479..748 CDD:133187 106/261 (41%)
Focal_AT 983..1112 CDD:308942
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.