DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and smal

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_723165.2 Gene:smal / 5740323 FlyBaseID:FBgn0085409 Length:939 Species:Drosophila melanogaster


Alignment Length:149 Identity:34/149 - (22%)
Similarity:54/149 - (36%) Gaps:34/149 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   666 KLAKDPDSQTKRSSSSSSECRS-SKDTSHSKKRSLSFSQKSISNIFSNLKEFSKSPLVRMGKNHI 729
            |..|.|.|:....||:::...| ...:|||.....|......|.|:.:          .:|    
  Fly   677 KPLKGPGSERSGCSSNTNTVSSGGGKSSHSHSSHCSTGGPDHSGIYDD----------GIG---- 727

  Fly   730 LNEEQDAKRTQPSQHHHSSGSDCPTNSSSSSS--------NNNNNNKNTSSNSNHSASQSTIITS 786
               ..::|.|.|..:.:|||     ||||:::        ....|.::...|....||...:..:
  Fly   728 ---TMNSKATAPMINPYSSG-----NSSSAAAAAAAEFQRARTYNFRSYPDNLXFEASLKLVAAA 784

  Fly   787 TITTTITTT---TTTTPSK 802
            ....|..|.   :||.|.|
  Fly   785 PKRITAATASAGSTTMPKK 803

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581
PTKc_Fes_like 1067..1315 CDD:270637
smalNP_723165.2 FA58C 78..234 CDD:214572
FA58C 81..233 CDD:238014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.