DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and ntrk3a

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_001243593.1 Gene:ntrk3a / 568668 ZFINID:ZDB-GENE-010126-3 Length:818 Species:Danio rerio


Alignment Length:320 Identity:107/320 - (33%)
Similarity:164/320 - (51%) Gaps:38/320 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  1021 PFASIQELIMHQYHSELPVTVKSGAILRRPVCRERWELSNDDVVLLERIGRGNFGDVYKAK---L 1082
            |.....:...|.::...|.|... .|.||            |:||...:|.|.||.|:.|:   |
Zfish   502 PVIENPQYFRHGHNCNKPATYVQ-HIKRR------------DIVLKRELGEGAFGKVFLAECYNL 553

  Fly  1083 KST--KLDVAVKTCR-MTLPDEQKRKFLQEGRILKQYDHPNIVKLIGICVQKQPIMIVMELVLGG 1144
            ..|  |:.|||||.: .||  ..::.|.:|..:|....|.:|||..|:||...|:::|.|.:..|
Zfish   554 SPTKDKMLVAVKTLKDPTL--AARKDFQREAELLTNLQHEHIVKFYGVCVDGDPLIMVFEYMKHG 616

  Fly  1145 SLLTYLRKN--------------SNG-LTTRQQMGMCRDAAAGMRYLESKNCIHRDLAARNCLVD 1194
            .|..:||.:              :|| |...|.:.:....|:||.||.|::.:|||||.|||||.
Zfish   617 DLNKFLRAHGPDAMILVDGQPLQTNGELGLSQMLHIASQIASGMVYLGSQHFVHRDLATRNCLVG 681

  Fly  1195 LEHSVKISDFGMSRE--EEEYIVSDGMKQIPVKWTAPEALNFGKYTSLCDVWSYGILMWEIFSKG 1257
            ....|||.||||||:  ..:|....|...:|::|..||::.:.|:|:..||||:|:::||||:.|
Zfish   682 NGLLVKIGDFGMSRDIYSTDYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSFGVILWEIFTYG 746

  Fly  1258 DTPYSGMTNSRARERIDTGYRMPTPKSTPEEMYRLMLQCWAADAESRPHFDEIYNVVDAL 1317
            ..|:..:.|:...|.|..|..:..|:..|:|:|.:||.||..:.:.|.:..:|..::.||
Zfish   747 KQPWFQLANNEVIECITQGRVLERPRLCPKEVYDIMLGCWQREPQQRLNIKDIQKILFAL 806

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 2/17 (12%)
TyrKc 1063..1311 CDD:197581 96/270 (36%)
PTKc_Fes_like 1067..1315 CDD:270637 95/270 (35%)
ntrk3aNP_001243593.1 LRR_8 101..157 CDD:290566
leucine-rich repeat 103..126 CDD:275378
leucine-rich repeat 127..150 CDD:275378
TPKR_C2 161..205 CDD:293525
I-set 207..298 CDD:254352
Ig_TrkABC_d4 208..298 CDD:143173
Ig 316..393 CDD:299845
PTKc_TrkC 525..811 CDD:270676 103/296 (35%)
STYKc 531..803 CDD:214568 97/273 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.