DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and map3k10

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:XP_689424.4 Gene:map3k10 / 560932 ZFINID:ZDB-GENE-050419-112 Length:1062 Species:Danio rerio


Alignment Length:270 Identity:85/270 - (31%)
Similarity:127/270 - (47%) Gaps:40/270 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1065 LLERIGRGNFGDVYKAKLKSTKLDVAVKTCRMTLPDEQ----KRKFLQEGRILKQYDHPNIVKLI 1125
            |.|.||.|.||.|||...::.  :||||..|.. |||.    .....||.|:.....|.||:.|.
Zfish   167 LEEVIGAGGFGKVYKGVWRAE--EVAVKAARQD-PDEDISATAENVRQEARLFWMLRHRNIIALR 228

  Fly  1126 GICVQKQPIMIVMELVLGGSLLTYLRKNSNGLTTRQQMGMCRDAAAGMRYLESKN---CIHRDLA 1187
            |:|:::..:.:|||...||:|...|.  ...:..|..:......|.||.||.::.   .|||||.
Zfish   229 GVCLREPNLCLVMEYARGGALNRALA--GKKVPPRVLVNWAVQIATGMDYLHNQTFVPIIHRDLK 291

  Fly  1188 ARNCLV-------DLE-HSVKISDFGMSRE--EEEYIVSDGMKQIPVKWTAPEALNFGKYTSLCD 1242
            :.|.|:       ||. .::||:|||::||  ....:.:.|    ...|.|||.:....::...|
Zfish   292 SSNILILEPVERDDLSGKTLKITDFGLAREWHRTTKMSAAG----TYAWMAPEVIKLSLFSKSSD 352

  Fly  1243 VWSYGILMWEIFSKGDTPYSGMTNSRARERIDTGY-------RMPTPKSTPEEMYRLMLQCWAAD 1300
            |||:|:|:||:.: |:.||      |..:.:...|       .:|.|.:.||...:|:.:||..:
Zfish   353 VWSFGVLLWELLT-GEVPY------REIDALAVAYGVAMNKLTLPIPSTCPEAFAQLLGECWCPN 410

  Fly  1301 AESRPHFDEI 1310
            ...||.|..|
Zfish   411 PRGRPAFGSI 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581 85/270 (31%)
PTKc_Fes_like 1067..1315 CDD:270637 84/268 (31%)
map3k10XP_689424.4 SH3_MLK1-3 81..138 CDD:212992
STYKc 165..424 CDD:214568 85/270 (31%)
STKc_MLK2 170..427 CDD:271050 83/267 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100013
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.