DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and MAP2K6

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:XP_011523328.1 Gene:MAP2K6 / 5608 HGNCID:6846 Length:337 Species:Homo sapiens


Alignment Length:315 Identity:77/315 - (24%)
Similarity:133/315 - (42%) Gaps:47/315 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1017 FEGPPFASIQELIMHQYHSELPVTVKSGAILRRPVCRERWELSNDDVVLLERIGRGNFGDVYKAK 1081
            ||.|           |..|..|..:.|.|.:  .:..:.:|:..||:..:..:|||.:|.|.|.:
Human    23 FEQP-----------QTSSTPPRDLDSKACI--SIGNQNFEVKADDLEPIMELGRGAYGVVEKMR 74

  Fly  1082 LKSTKLDVAVKTCRMTLPDEQKRKFLQEGRI-LKQYDHPNIVKLIGICVQKQPIMIVMELVLGGS 1145
            ...:...:|||..|.|:..:::::.|.:..| ::..|.|..|...|...::..:.|.|||:....
Human    75 HVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSL 139

  Fly  1146 LLTYLRKNSNGLTTRQQM--GMCRDAAAGMRYLESK-NCIHRDLAARNCLVDLEHSVKISDFGMS 1207
            ...|.:....|.|..:.:  .:.......:.:|.|| :.||||:...|.|::....||:.|||:|
Human   140 DKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGIS 204

  Fly  1208 REEEEYIVSDGMKQIPV---KWTAPE----ALNFGKYTSLCDVWSYGILMWEI------FSKGDT 1259
                .|:|....|.|..   .:.|||    .||...|:...|:||.||.|.|:      :....|
Human   205 ----GYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGT 265

  Fly  1260 PYSGMTNSRARERIDTGYRMPTPKSTPE----EMYRLMLQCWAADAESRPHFDEI 1310
            |:         :::......|:|:...:    |......||...:::.||.:.|:
Human   266 PF---------QQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPEL 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 5/21 (24%)
TyrKc 1063..1311 CDD:197581 66/269 (25%)
PTKc_Fes_like 1067..1315 CDD:270637 66/265 (25%)
MAP2K6XP_011523328.1 PKc_MKK3_6 54..336 CDD:173729 68/271 (25%)
S_TKc 57..317 CDD:214567 66/268 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.