DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and csk

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_001071067.1 Gene:csk / 556454 ZFINID:ZDB-GENE-061103-493 Length:450 Species:Danio rerio


Alignment Length:376 Identity:131/376 - (34%)
Similarity:198/376 - (52%) Gaps:30/376 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   960 WFHGVLPREEVVRLL--NNDGDFLVRETIRNEESQIVLSVCWNGH-KHF-IVQTTGEGNFRFEGP 1020
            ||||.:.||:..|||  ...|.|||||: .|......|.|..:|. :|: |:...|:.:.. |..
Zfish    82 WFHGKITREQAERLLYPPETGLFLVRES-TNYPGDYTLCVSCDGKVEHYRIIYHNGKLSID-EEE 144

  Fly  1021 PFASIQELIMHQYHSEL---------PVTVKSGAILRRPVCRERWELSNDDVVLLERIGRGNFGD 1076
            .|.::.:|:.| |..:.         |..::.....:....|..|.|:..::.|::.||:|.|||
Zfish   145 YFENLMQLMEH-YTKDADGLCTRLIKPKIMEG
TVAAQDEFSRSGWALNRKELKLIQTIGKGEFGD 208

  Fly  1077 VYKAKLKSTKLDVAVKTCRMTLPDEQKRKFLQEGRILKQYDHPNIVKLIGICV-QKQPIMIVMEL 1140
            |.....:..|  ||||..:   .|...:.|:.|..::.|..|.|:|:|:|:.| :|..:.||.|.
Zfish   209 VMVGDYRGKK--VAVKCIK---HDATAQAFVAEASVMTQLRHNNLVQLLGVIVEEKGSLYIVTEY 268

  Fly  1141 VLGGSLLTYLRKNSNGLTT---RQQMGMCRDAAAGMRYLESKNCIHRDLAARNCLVDLEHSVKIS 1202
            :..|||:.|||  |.|.|.   .:.:....|....|.|||:.|.:||||||||.||..::..|:|
Zfish   269 MAKGSLVDYLR--SRGRTVIGGDRLINFSMDVCKAMEYLEANNFVHRDLAARNVLVSEDNIAKVS 331

  Fly  1203 DFGMSREEEEYIVSDGMKQIPVKWTAPEALNFGKYTSLCDVWSYGILMWEIFSKGDTPYSGMTNS 1267
            |||:::|...   :....::|||||:||||...|:::..||||||||:|||:|.|..||..:...
Zfish   332 DFGLTKEASS---TQDTAKLPVKWTSPEALREKKFSTKSDVWSYGILLWEIYSFGRVPYPRIPLK 393

  Fly  1268 RARERIDTGYRMPTPKSTPEEMYRLMLQCWAADAESRPHFDEIYNVVDALI 1318
            ....|::.||:|.:|...|..:|.:|.|||..||..||.|.::...:..:|
Zfish   394 EVVPRVEKGYKMDSPDGCPPVVYDIMKQCWTLDAVVRPSFRDLREKLQDII 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 27/91 (30%)
TyrKc 1063..1311 CDD:197581 99/251 (39%)
PTKc_Fes_like 1067..1315 CDD:270637 98/251 (39%)
cskNP_001071067.1 SH3_CSK 11..67 CDD:212703
SH2_csk_like 78..175 CDD:198190 28/95 (29%)
PTKc_Csk 188..443 CDD:133213 101/264 (38%)
STYKc 195..440 CDD:214568 99/254 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.