DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and ptk7a

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_001018501.1 Gene:ptk7a / 553690 ZFINID:ZDB-GENE-050522-216 Length:231 Species:Danio rerio


Alignment Length:189 Identity:43/189 - (22%)
Similarity:65/189 - (34%) Gaps:57/189 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   470 MTRSRQGRFNKLQPRSQSL--GSLSVIR-DGNGPSPARY------EPITN--HRLRQAASVHYLG 523
            |.::....|.| .|:||..  |..:::| :.|.|....|      ||:||  .|.....::.:..
Zfish    30 MAQAASFYFTK-APKSQDALHGRSAMLRCEVNDPQGVSYAWIQNGEPVTNSERRFLDGGNLKFTA 93

  Fly   524 EEIATSSTNPPDLTRLRRTQC--SMLCLGEDEE--------------PVVLASPAPLTQL--TAA 570
            .:....|.|         .||  |....||:|.              .|.|.||..:.::  ::.
Zfish    94 IDRTLDSGN---------FQCIASKNSTGEEERTAETSFNIKWLESGAVSLKSPESVAEIQSSSQ 149

  Fly   571 VLTNTNNNHIYADLELDKKKDTSPSPECK----GEQIQPKKEQI-RIEINQTAPQNSID 624
            |:...|             .|..|.|..:    |.||..|..:| ..|.:.|.|..|.|
Zfish   150 VILRCN-------------IDGHPRPTNRWFKDGTQITEKNYKINNKERSLTLPNASPD 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581
PTKc_Fes_like 1067..1315 CDD:270637
ptk7aNP_001018501.1 I-set 37..120 CDD:254352 23/92 (25%)
Ig 42..122 CDD:299845 21/88 (24%)
Ig 150..222 CDD:299845 15/59 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.