DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and grapa

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_001018409.1 Gene:grapa / 553596 ZFINID:ZDB-GENE-050522-347 Length:214 Species:Danio rerio


Alignment Length:117 Identity:33/117 - (28%)
Similarity:53/117 - (45%) Gaps:15/117 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   916 IDNDEEEEDSASDDVLSMKDHCYCVPSLAASISLSTNRPLYEEEWFHGVLPREEVV-RLLNND-G 978
            |.|.|::.:..:.:.::.|.:   ||....|:     ||   ..||.|.:.|.... ||...| |
Zfish    27 ITNMEDDPNWYTAEFVNRKGY---VPKNYISL-----RP---HAWFAGRISRHVAENRLHQRDCG 80

  Fly   979 DFLVRETIRNEESQIVLSVCWNGH-KHFIVQTTGEGNFRFEGPPFASIQELI 1029
            .|||||: .:...:..:||.:..| :||.|....||.:......|.|:.:|:
Zfish    81 SFLVRES-ESAPGEFSMSVSYGDHVQHFKVLKDREGYYFVWEEIFPSLNQLV 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 26/80 (33%)
TyrKc 1063..1311 CDD:197581
PTKc_Fes_like 1067..1315 CDD:270637
grapaNP_001018409.1 SH3 2..55 CDD:302595 6/30 (20%)
SH2_Grb2_like 56..149 CDD:199828 26/80 (33%)
SH3_GRB2_like_C 159..211 CDD:212739
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.