DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and ror2

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_001015834.1 Gene:ror2 / 548551 XenbaseID:XB-GENE-491498 Length:930 Species:Xenopus tropicalis


Alignment Length:317 Identity:103/317 - (32%)
Similarity:151/317 - (47%) Gaps:46/317 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1021 PFASIQELIMHQYHSELPVTVKSGAILRRPVCRERWELSNDDVVLLERIGRGNFGDVYKAKLKST 1085
            |...::..:|:| |.:.| .||              |::...|..:|.:|...||.|||..|..|
 Frog   444 PSQDMEMPLMNQ-HKQQP-KVK--------------EINLSTVRFMEELGEDRFGKVYKGHLFGT 492

  Fly  1086 -----KLDVAVKTCRMTLPDEQKRKFLQEGRILKQYDHPNIVKLIGICVQKQPIMIVMELVLGGS 1145
                 ...||:||.:..:....:.:|..|..:..:..|||||.|||...::||    |.:|...|
 Frog   493 TPGEQTQTVAIKTLKDKVEVALREEFKHEAMMRSRLQHPNIVCLIGTVTKEQP----MSMVFSYS 553

  Fly  1146 LLTYLRKNSNGLTTRQQMGMCRD-------------------AAAGMRYLESKNCIHRDLAARNC 1191
            .|:.|.:.....:....:|...|                   .||||.:|.|.:.:|:||||||.
 Frog   554 PLSDLHEFLVMRSPHSDVGSTDDDKTVKSTLEPTDFLHIVTQIAAGMEFLSSHHVVHKDLAARNV 618

  Fly  1192 LVDLEHSVKISDFGMSRE--EEEYIVSDGMKQIPVKWTAPEALNFGKYTSLCDVWSYGILMWEIF 1254
            ||..:.||||||.|:.||  ..:|....|...:|::|.:|||:.:||.:...|:||||:|:||||
 Frog   619 LVFDKLSVKISDLGLFREVYAADYYKLMGNSMLPIRWMSPEAITYGKCSVDSDIWSYGVLLWEIF 683

  Fly  1255 SKGDTPYSGMTNSRARERIDTGYRMPTPKSTPEEMYRLMLQCWAADAESRPHFDEIY 1311
            |.|..||.|.:|....|.:.....:..|...|..:|.|||:||:.....||.|.:|:
 Frog   684 SYGLQPYCGYSNQDVIEMVRNRQVLLCPDDCPAWIYTLMLECWSEFPARRPRFKDIH 740

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 4/17 (24%)
TyrKc 1063..1311 CDD:197581 94/273 (34%)
PTKc_Fes_like 1067..1315 CDD:270637 94/271 (35%)
ror2NP_001015834.1 I-set 62..150 CDD:369462
CRD_TK_ROR2 168..305 CDD:143577
KR 310..390 CDD:214527
PKc_like 463..746 CDD:389743 97/296 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.