powered by:
Protein Alignment FER and mst1r
DIOPT Version :9
Sequence 1: | NP_524288.3 |
Gene: | FER / 41118 |
FlyBaseID: | FBgn0000723 |
Length: | 1325 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001008091.1 |
Gene: | mst1r / 493453 |
XenbaseID: | XB-GENE-480211 |
Length: | 216 |
Species: | Xenopus tropicalis |
Alignment Length: | 71 |
Identity: | 19/71 - (26%) |
Similarity: | 32/71 - (45%) |
Gaps: | 18/71 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 40 CDKEYAISLTAVAQQGLKIDRADEMQGSLISKSWRSY-MDELDHQAKQFKFNAEQLEVVCDKLTH 103
||.::.|||..:.:|. |..|.:: ::|| |....|..:.|..|.| .|:|
Frog 109 CDTDHVISLRLILRQP--------------SPVWLNFNLEEL--QINPTKKQSPQKRVSC-WLSH 156
Fly 104 LSQDKR 109
|.|:::
Frog 157 LPQEEQ 162
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.