DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and ROR2

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_004551.2 Gene:ROR2 / 4920 HGNCID:10257 Length:943 Species:Homo sapiens


Alignment Length:279 Identity:92/279 - (32%)
Similarity:141/279 - (50%) Gaps:24/279 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly  1057 ELSNDDVVLLERIGRGNFGDVYKAKL------KSTKLDVAVKTCRMTLPDEQKRKFLQEGRILKQ 1115
            |:|...|..:|.:|...||.|||..|      :.|:. ||:||.:.......:.:|..|..:..:
Human   467 EISLSAVRFMEELGEDRFGKVYKGHLFGPAPGEQTQA-VAIKTLKDKAEGPLREEFRHEAMLRAR 530

  Fly  1116 YDHPNIVKLIGICVQKQPIMIVMELVLGGSLLTYL---------------RKNSNGLTTRQQMGM 1165
            ..|||:|.|:|:..:.||:.::......|.|..:|               |...:.|.....:.:
Human   531 LQHPNVVCLLGVVTKDQPLSMIFSYCSHGDLHEFLVMRSPHSDVGSTDDDRTVKSALEPPDFVHL 595

  Fly  1166 CRDAAAGMRYLESKNCIHRDLAARNCLVDLEHSVKISDFGMSRE--EEEYIVSDGMKQIPVKWTA 1228
            ....||||.||.|.:.:|:|||.||.||..:.:|||||.|:.||  ..:|....|...:|::|.|
Human   596 VAQIAAGMEYLSSHHVVHKDLATRNVLVYDKLNVKISDLGLFREVYAADYYKLLGNSLLPIRWMA 660

  Fly  1229 PEALNFGKYTSLCDVWSYGILMWEIFSKGDTPYSGMTNSRARERIDTGYRMPTPKSTPEEMYRLM 1293
            |||:.:||::...|:||||:::||:||.|..||.|.:|....|.|.....:|.|...|..:|.||
Human   661 PEAIMYGKFSIDSDIWSYGVVLWEVFSYGLQPYCGYSNQDVVEMIRNRQVLPCPDDCPAWVYALM 725

  Fly  1294 LQCWAADAESRPHFDEIYN 1312
            ::||......||.|.:|::
Human   726 IECWNEFPSRRPRFKDIHS 744

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581 89/270 (33%)
PTKc_Fes_like 1067..1315 CDD:270637 89/269 (33%)
ROR2NP_004551.2 I-set 64..152 CDD:254352
IGc2 75..141 CDD:197706
CRD_TK_ROR2 170..309 CDD:143577
KR 314..395 CDD:214527
PTKc_Ror2 466..749 CDD:270673 92/279 (33%)
Pkinase_Tyr 473..746 CDD:285015 90/273 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 757..796
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 850..931
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.