DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and ROR1

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_005003.2 Gene:ROR1 / 4919 HGNCID:10256 Length:937 Species:Homo sapiens


Alignment Length:281 Identity:96/281 - (34%)
Similarity:140/281 - (49%) Gaps:30/281 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1057 ELSNDDVVLLERIGRGNFGDVYKAKLKSTKLD----VAVKTCRMTLPDEQKRKFLQEGRILKQYD 1117
            ||....|..:|.:|...||.:||..|....:|    ||:||.:.....:|..:|.||..::.:..
Human   467 ELPLSAVRFMEELGECAFGKIYKGHLYLPGMDHAQLVAIKTLKDYNNPQQWTEFQQEASLMAELH 531

  Fly  1118 HPNIVKLIGICVQKQPIMIVMELVLGGSLLTYLRKNSNGLTTRQQMGMCRD-------------- 1168
            |||||.|:|...|:||:.::.|.:..|.|..:|...|    ....:|...|              
Human   532 HPNIVCLLGAVTQEQPVCMLFEYINQGDLHEFLIMRS----PHSDVGCSSDEDGTVKSSLDHGDF 592

  Fly  1169 ------AAAGMRYLESKNCIHRDLAARNCLVDLEHSVKISDFGMSRE--EEEYIVSDGMKQIPVK 1225
                  .||||.||.|...:|:||||||.|:..:..|||||.|:|||  ..:|........:|::
Human   593 LHIAIQIAAGMEYLSSHFFVHKDLAARNILIGEQLHVKISDLGLSREIYSADYYRVQSKSLLPIR 657

  Fly  1226 WTAPEALNFGKYTSLCDVWSYGILMWEIFSKGDTPYSGMTNSRARERIDTGYRMPTPKSTPEEMY 1290
            |..|||:.:||::|..|:||:|:::|||||.|..||.|.:|....|.:.....:|..:..|..||
Human   658 WMPPEAIMYGKFSSDSDIWSFGVVLWEIFSFGLQPYYGFSNQEVIEMVRKRQLLPCSEDCPPRMY 722

  Fly  1291 RLMLQCWAADAESRPHFDEIY 1311
            .||.:||......||.|.:|:
Human   723 SLMTECWNEIPSRRPRFKDIH 743

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581 93/273 (34%)
PTKc_Fes_like 1067..1315 CDD:270637 93/271 (34%)
ROR1NP_005003.2 IG_like 66..148 CDD:214653
CRD_TK_ROR1 166..307 CDD:143576
KR 311..393 CDD:214527
PTKc_Ror1 467..749 CDD:270672 96/281 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 753..779
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 833..890
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.