DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and Src64B

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_001286937.1 Gene:Src64B / 48973 FlyBaseID:FBgn0262733 Length:553 Species:Drosophila melanogaster


Alignment Length:408 Identity:150/408 - (36%)
Similarity:223/408 - (54%) Gaps:45/408 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   949 LSTNRPLYEEEWFHGVLPREEVVRLL----NNDGDFLVRETIRNEESQIVLSVCW---NGH--KH 1004
            ::..|.:..|:||...:.|:|..:||    |..|.||||.:..|.....:....|   .|:  ||
  Fly   151 VAEERSVNSEDWFFENVLRKEADKLLLAEENPRGTFLVRPSEHNPNGYSLSVKDWEDGRGYHVKH 215

  Fly  1005 FIVQTTGEGNFRF-EGPPFASIQELIMHQYHSELPVTVKSGAILRRPVC--------------RE 1054
            :.::....|.:.. ....|.|:|.|:| .|..|..:.:..  ||.|| |              |:
  Fly   216 YRIKPLDNGGYYIATNQTFPSLQALVM-AYSKENALGLCH--ILSRP-CPKPQPQMWDLGPELRD 276

  Fly  1055 RWELSNDDVVLLERIGRGNFGDVYKAKLKSTKLDVAVKTCRM-TLPDEQKRKFLQEGRILKQYDH 1118
            ::|:...::.||.::||||||:|:..|.::: :||||||.|. |:   ....||||..|:|::.|
  Fly   277 KYEIPRSEIQLLRKLGRGNFGEVFYGKWRNS-IDVAVKTLREGTM---STAAFLQEAAIMKKFRH 337

  Fly  1119 PNIVKLIGICVQKQPIMIVMELVLGGSLLTYLRK-NSNGLTTRQQMGMCRDAAAGMRYLESKNCI 1182
            ..:|.|..:|.|::||.||.|.:..||||.:||: :...|.....:.:....|:||.|||||..|
  Fly   338 NRLVALYAVCSQEEPIYIVQEYMSKGSLLDFLREGDGRYLHFEDLIYIATQVASGMEYLESKQLI 402

  Fly  1183 HRDLAARNCLVDLEHSVKISDFGMSR--EEEEYIVSDGMKQIPVKWTAPEALNFGKYTSLCDVWS 1245
            ||||||||.|:...:..||.|||::|  .::||....| .:.|||||||||:.:||::...||||
  Fly   403 HRDLAARNVLIGENNVAKICDFGLARVIADDEYCPKQG-SRFPVKWTAPEAIIYGKFSIKSDVWS 466

  Fly  1246 YGILMWEIFSKGDTPYSGMTNSRARERIDTGYRMPTPKS--TPEEMYRLMLQCWAADAESRP--- 1305
            ||||:.|:|:.|..||.||.:....|.|:.|:|||.|.:  .|:.:|:|:||||.|..|.||   
  Fly   467 YGILLMELFTYGQVPYPGMHSREVIENIERGFRMPKPTNHYFPDNIYQLLLQCWDAVPEKRPTFE 531

  Fly  1306 ---HFDEIYNVVDALILR 1320
               |:.|.::|...:..|
  Fly   532 FLNHYFESFSVTSEVPYR 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 27/95 (28%)
TyrKc 1063..1311 CDD:197581 114/259 (44%)
PTKc_Fes_like 1067..1315 CDD:270637 113/259 (44%)
Src64BNP_001286937.1 SH3_Src_like 99..150 CDD:212779
SH2_Src_family 158..259 CDD:199827 28/103 (27%)
STYKc 285..537 CDD:214568 113/256 (44%)
PTKc_Src_like 289..538 CDD:270630 111/253 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468361
Domainoid 1 1.000 165 1.000 Domainoid score I1208
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D17578at33392
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24418
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.