DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and AgaP_AGAP009158

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:XP_001238226.1 Gene:AgaP_AGAP009158 / 4578387 VectorBaseID:AGAP009158 Length:547 Species:Anopheles gambiae


Alignment Length:384 Identity:76/384 - (19%)
Similarity:114/384 - (29%) Gaps:173/384 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   856 FDFAKEFEVEQPAGSAADEQFCNCPPAGQKPVKPSVQISGHKDHPFESSSGELDENSDRDIDNDE 920
            :||.|:|::.||.                                .||    :...::|..||| 
Mosquito    77 YDFIKKFDISQPV--------------------------------LES----IYRYAERKCDND- 104

  Fly   921 EEEDSASDDVLSMKDHCYCVPSLAASISLSTNRPLYEEEWFHGVLPREEVVRLLNNDGDFLVRET 985
                  .|| ..|.....|...:..::.|:   |.||                   |..|||:..
Mosquito   105 ------CDD-YGMFVPTQCAQGVKCALVLA---PHYE-------------------DTRFLVQHI 140

  Fly   986 IRNEESQIVLSVCWNGHK-----HFIVQTTGEGNFRFEGPPFASIQELIMHQYHSE--------- 1036
               .|....|.|.|.|.:     ..::.|.| |: |..|..|     |:.|...||         
Mosquito   141 ---TEMNFQLKVIWLGDRLKLGIRQLMNTYG-GD-RKNGKKF-----LVFHWTPSEVINTRTMEY 195

  Fly  1037 LPVTVKSGAILRRPVCRERWELSNDD------VVLLERIGRGNFGDVYKAKLKSTKLDVAVKTCR 1095
            :|:|:        |.| |....|||.      ..||:..|:           |..:.|.|..:..
Mosquito   196 VPITM--------PRC-EDMIASNDTGCKYEMTPLLKYYGK-----------KFREADYAFNSLI 240

  Fly  1096 MTLPDEQKRKFLQEGRILKQYD--HPNIVKL--------------------------IGICVQKQ 1132
            :|..:||..:     :|...||  .|.|:::                          ....::.:
Mosquito   241 LTHFEEQSMQ-----QIFDLYDAHEPEIMRVREEGDPDQTRVAEIYNQIACEWMRAQESTWMRWK 300

  Fly  1133 PIMIVMELVLGG-----------------SLLTYLRKNSNG-------LTTRQQMGMCR 1167
            |.....|:.:||                 :||.....|.||       ||.:|..|.||
Mosquito   301 PEDPKEEVYIGGIFPLTGMGPSYLGIAPAALLAQDHINGNGTILPNYELTVQQNDGQCR 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 22/99 (22%)
TyrKc 1063..1311 CDD:197581 29/157 (18%)
PTKc_Fes_like 1067..1315 CDD:270637 27/153 (18%)
AgaP_AGAP009158XP_001238226.1 Csm6_III-A 68..>176 CDD:302754 34/169 (20%)
Periplasmic_Binding_Protein_Type_1 309..>539 CDD:299141 13/51 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.