DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and AgaP_AGAP009157

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:XP_001238225.2 Gene:AgaP_AGAP009157 / 4578386 VectorBaseID:AGAP009157 Length:347 Species:Anopheles gambiae


Alignment Length:272 Identity:97/272 - (35%)
Similarity:152/272 - (55%) Gaps:15/272 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly  1054 ERWELSNDDVVLLERIGRGNFGDVYKAKLK---STKLDVAVKTCRMTLPDEQKRKFLQEGRILKQ 1115
            ::||:..|.||:..|:|.|.||.||..:.:   .....|||||.::....|.|..||.|...:|:
Mosquito     5 DKWEIPKDRVVINRRLGEGAFGTVYGGEAQIGDEGWTAVAVKTLKVGSTTEDKVDFLSEAEAMKR 69

  Fly  1116 YDHPNIVKLIGICVQKQPIMIVMELVLGGSLLTYL----------RKNSNGLTTRQQMGMCRDAA 1170
            :||.|||:|:|:|:|.:|:..|||.:|.|.|.|||          :...:.::.::...|..|.:
Mosquito    70 FDHNNIVRLLGVCLQSEPVYTVMEFMLYGDLKTYLLARRHLVNSKQSEDSDISNKRLTMMALDVS 134

  Fly  1171 AGMRYLESKNCIHRDLAARNCLVDLEHSVKISDFGMSRE--EEEYIVSDGMKQIPVKWTAPEALN 1233
            ..:.||..:..:|||:|.|||:|:.:..||:.||||:|.  |.:|...:....:||:|.|||:|.
Mosquito   135 RALSYLAEQKYVHRDVACRNCMVNAQRVVKLGDFGMARPTFENDYYRFNRRGMLPVRWMAPESLG 199

  Fly  1234 FGKYTSLCDVWSYGILMWEIFSKGDTPYSGMTNSRARERIDTGYRMPTPKSTPEEMYRLMLQCWA 1298
            .|.:|...||||||:|::||.:.|..|:.|:||::..|.:..|..:..|.....::..||..||.
Mosquito   200 LGIFTPASDVWSYGVLLYEIITFGSFPFQGLTNNQVLEHLKNGNTITIPAGVKPQLEGLMKACWN 264

  Fly  1299 ADAESRPHFDEI 1310
            .|.:.||...|:
Mosquito   265 QDYKKRPSASEV 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581 94/263 (36%)
PTKc_Fes_like 1067..1315 CDD:270637 92/259 (36%)
AgaP_AGAP009157XP_001238225.2 STYKc 14..280 CDD:214568 94/263 (36%)
PTKc 18..280 CDD:270623 92/259 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.