DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and AgaP_AGAP008742

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:XP_314860.4 Gene:AgaP_AGAP008742 / 4578049 VectorBaseID:AGAP008742 Length:252 Species:Anopheles gambiae


Alignment Length:185 Identity:38/185 - (20%)
Similarity:67/185 - (36%) Gaps:50/185 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   455 GRHFKRKSTP---QPATPMTRSRQGRFNKLQPRSQSLG--------------SLSVIRDGNGPSP 502
            |:||..:...   .|.|.|..:|.... ||..|   :|              .||.|...:.|..
Mosquito    59 GQHFTGEPVQFSYMPDTVMENARDVTI-KLHHR---VGRYVQIHLYFALRWIMLSEISFNSAPVT 119

  Fly   503 ARY--EPITNHRLRQAASVHY--LGEEIATSSTNPPDLTRLRRTQCSMLCLGE---DEEP----- 555
            ..:  |.:..:.:.|..|:.|  ..:|...:..|..:...:.:::|:...:..   |:||     
Mosquito   120 GNFSDEEVNGNSISQENSIEYPLQRDESGINIVNKGERNHVTQSKCTTSLISPKPIDQEPEPHFV 184

  Fly   556 -VVLASPAPLTQL----------------TAAVLTNTNNNHIYADLELDKKKDTS 593
             ||:|:...:..|                |||||....:|.....|.:||:.:::
Mosquito   185 GVVIAALTTIILLLIVIIMFIVAKNKRTRTAAVLDALQHNLHTDSLGIDKRLNSN 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581
PTKc_Fes_like 1067..1315 CDD:270637
AgaP_AGAP008742XP_314860.4 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.