DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and slpr

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster


Alignment Length:374 Identity:101/374 - (27%)
Similarity:158/374 - (42%) Gaps:88/374 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   985 TIRNEESQIVLSV---------CWNGH---------KHFIVQTTGEGNFRFEGPPFASIQELIMH 1031
            |:|..|..:|||.         .|.|.         |.|:..         |.|           
  Fly    63 TLRRGEIVVVLSTDSEVSGDVGWWTGKIGDKVGVFPKDFVTD---------EDP----------- 107

  Fly  1032 QYHSELPVTVKSGAILRRPVCRERWELSNDDVVLLERIGRGNFGDVYKAKLKSTKLDVAVKTCRM 1096
               .:|.|:...|.|       :..|:..:::.:.|.||.|.|..|::......  :||:|....
  Fly   108 ---LQLNVSSAIGDI-------QPHEIEYNELDIKEVIGSGGFCKVHRGYYDGE--EVAIKIAHQ 160

  Fly  1097 TLPDEQKR---KFLQEGRILKQYDHPNIVKLIGICVQKQPIMIVMELVLGGSLLTYLRKNSNGLT 1158
            |..|:.:|   ..|||.::.....|.||..|.|:|:..: :.:|||...||||...|   :..:.
  Fly   161 TGEDDMQRMRDNVLQEAKLFWALKHENIAALRGVCLNTK-LCLVMEYARGGSLNRIL---AGKIP 221

  Fly  1159 TRQQMGMCRDAAAGMRYLESK---NCIHRDLAARNCL----VDLEH----SVKISDFGMSRE--E 1210
            ....:......|.||.||.::   :.|||||.:.|.|    ::..|    ::||:|||::||  .
  Fly   222 PDVLVNWAIQIARGMNYLHNEAPMSIIHRDLKSSNVLIYEAIEGNHLQQKTLKITDFGLAREMYN 286

  Fly  1211 EEYIVSDGMKQIPVKWTAPEALNFGKYTSLCDVWSYGILMWEIFSKGDTPYSGMTNSRARERIDT 1275
            .:.:.:.|    ...|..||.::...|:...||||||:|:||:.: |:|||.|.      :.:..
  Fly   287 TQRMSAAG----TYAWMPPEVISVSTYSKFSDVWSYGVLLWELIT-GETPYKGF------DPLSV 340

  Fly  1276 GY-------RMPTPKSTPEEMYRLMLQCWAADAESRPHFDEIYNVVDAL 1317
            .|       .:|.||:.||....||..||..|...||.|.||...::::
  Fly   341 AYGVAVNTLTLPIPKTCPETWGALMKSCWQTDPHKRPGFKEILKQLESI 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 13/71 (18%)
TyrKc 1063..1311 CDD:197581 83/270 (31%)
PTKc_Fes_like 1067..1315 CDD:270637 84/270 (31%)
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809 10/40 (25%)
TyrKc 129..386 CDD:197581 84/273 (31%)
STKc_MLK 134..389 CDD:270963 83/271 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100013
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.