DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and Ret

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_477044.1 Gene:Ret / 43875 FlyBaseID:FBgn0011829 Length:1235 Species:Drosophila melanogaster


Alignment Length:286 Identity:91/286 - (31%)
Similarity:147/286 - (51%) Gaps:24/286 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly  1055 RWELSNDDVVLLERIGRGNFGDVYKAKLKSTKL-------DVAVKTCRMTLPDEQKRKFLQEGRI 1112
            :||...:.:.|...:|.|.||.|.|.  .:|::       .||||..:......:....|.|.::
  Fly   763 KWEFPREKLQLDTVLGEGEFGQVLKG--FATEIAGLPGITTVAVKMLKKGSNSVEYMALLSEFQL 825

  Fly  1113 LKQYDHPNIVKLIGICVQKQPIMIVMELVLGGSLLTYLRKN----------SNG---LTTRQQMG 1164
            |::..|||::||:|.|...:..::::|....|||.:|||.:          ::|   :..:..:.
  Fly   826 LQEVSHPNVIKLLGACTSSEAPLLIIEYARYGSLRSYLRLSRKIECAGVDFADGVEPVNVKMVLT 890

  Fly  1165 MCRDAAAGMRYLESKNCIHRDLAARNCLVDLEHSVKISDFGMSRE--EEEYIVSDGMKQIPVKWT 1227
            .......||.||.....:||||||||.|:......||||||::|:  |::..:.....::||||.
  Fly   891 FAWQICKGMAYLSELKLVHRDLAARNVLLADGKICKISDFGLTRDVYEDDAYLKRSRDRVPVKWM 955

  Fly  1228 APEALNFGKYTSLCDVWSYGILMWEIFSKGDTPYSGMTNSRARERIDTGYRMPTPKSTPEEMYRL 1292
            |||:|....|||..||||:|:|.||:.:.|.:||.|:........:.|||||..|::..|.:|.:
  Fly   956 APESLADHVYTSKSDVWSFGVLCWELITLGASPYPGIAPQNLWSLLKTGYRMDRPENCSEAVYSI 1020

  Fly  1293 MLQCWAADAESRPHFDEIYNVVDALI 1318
            :..|||.:...||.|..:.:..:.|:
  Fly  1021 VRTCWADEPNGRPSFKFLASEFEKLL 1046

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581 88/269 (33%)
PTKc_Fes_like 1067..1315 CDD:270637 87/269 (32%)
RetNP_477044.1 PKc_like 770..1049 CDD:304357 89/279 (32%)
TyrKc 771..1042 CDD:197581 88/272 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 165 1.000 Domainoid score I1208
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.