DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and cdi

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_524401.2 Gene:cdi / 42289 FlyBaseID:FBgn0004876 Length:1213 Species:Drosophila melanogaster


Alignment Length:351 Identity:91/351 - (25%)
Similarity:148/351 - (42%) Gaps:58/351 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  1007 VQTTGEGNFRFEGPPFASIQELIMHQ-YHS---------ELPV--TVKSGAILRRPVCRE-RWEL 1058
            |.|:..|:...|.|        :.|| .|:         ..||  |:.|..::....||. |..:
  Fly    46 VTTSTNGDATAEAP--------VKHQPLHNGGWIGNGLPPAPVTRTISSDRLVTGSSCRALRTAV 102

  Fly  1059 SN----DDVVLLERIGRGNFGDVYKAKLKSTKLDVAVKTCRMTLPDEQKRKFLQEGRILKQYDHP 1119
            |.    ||.| .|:||.|.|.:|||...::|.   .|...:|......:...|:|.::|.:..|.
  Fly   103 SALYSVDDFV-KEKIGSGFFSEVYKVTHRTTG---QVMVLKMNQLRANRPNMLREVQLLNKLSHA 163

  Fly  1120 NIVKLIGICVQKQPIMIVMELVLGGSLLTYLRKNSNGLTTRQQMGMCRDAAAGMRYLESKNCIHR 1184
            ||:..:|:|||:..:..:.|.:.||||...|......|:..|::.:....|.||.|:......||
  Fly   164 NILSFMGVCVQEGQLHALTEYINGGSLEQLLANKEVVLSATQKIRLALGIARGMSYVHDAGIFHR 228

  Fly  1185 DLAARNCLV----DLEHSVKISDFGMSREEEEYIVSDGMKQIPVK-------------WTAPEAL 1232
            ||.::|.|:    :.::...:.|||::            .:||||             |.:||.|
  Fly   229 DLTSKNVLIRNLANDQYEAVVGDFGLA------------AKIPVKSRKSRLETVGSPYWVSPECL 281

  Fly  1233 NFGKYTSLCDVWSYGILMWEIFSKGDTPYSGMTNSRARERIDTGYRMPTPKSTPEEMYRLMLQCW 1297
            ....|....||:|:||:..||.::.:.....|..:.:.......:....|..||....||...|.
  Fly   282 KGQWYDQTSDVFSFGIIQCEIIARIEADPDMMPRTASFGLDYLAFVELCPMDTPPVFLRLAFYCC 346

  Fly  1298 AADAESRPHFDEIYNVVDALILRLDN 1323
            ..||:|||.|.:....:..|:.:.::
  Fly   347 LYDAKSRPTFHDATKKLTLLLEKYEH 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 8/41 (20%)
TyrKc 1063..1311 CDD:197581 72/264 (27%)
PTKc_Fes_like 1067..1315 CDD:270637 71/264 (27%)
cdiNP_524401.2 TyrKc 113..363 CDD:197581 71/264 (27%)
PKc_like 116..370 CDD:304357 71/268 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.