DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and MATK

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_002369.2 Gene:MATK / 4145 HGNCID:6906 Length:508 Species:Homo sapiens


Alignment Length:393 Identity:140/393 - (35%)
Similarity:200/393 - (50%) Gaps:58/393 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   948 SLSTNRPLYEEEWFHGVLPREEVVRLLN--NDGDFLVRETIRNEESQIVLSVCW----------- 999
            :||.:..|....||||.:..:|.|:.|.  .||.|||||:.|: ....||.|.:           
Human   111 ALSADPKLSLMPWFHGKISGQEAVQQLQPPEDGLFLVRESARH-PGDYVLCVSFGRDVIHYRVLH 174

  Fly  1000 -NGHKHFIVQTTGEGNFRFEGPPFASIQELIMHQYHSELPVTVKSGAI---LRRP---------- 1050
             :||     .|..|..|      |.::.:::.| |..:      .|||   |.||          
Human   175 RDGH-----LTIDEAVF------FCNLMDMVEH-YSKD------KGAICTKLVRPKRKHGTKSAE 221

  Fly  1051 --VCRERWELSNDDVVLLERIGRGNFGDVYKAKLKSTKLDVAVKTCRMTLPDEQKRKFLQEGRIL 1113
              :.|..|.|:...:.|..:||.|.||.|.:.:....|  ||||..:.   |...:.||.|..::
Human   222 EELARAGWLLNLQHLTLGAQIGEGEFGAVLQGEYLGQK--VAVKNIKC---DVTAQAFLDETAVM 281

  Fly  1114 KQYDHPNIVKLIGICVQKQPIMIVMELVLGGSLLTYLRKNSNGL-TTRQQMGMCRDAAAGMRYLE 1177
            .:..|.|:|:|:|: :..|.:.||||.|..|:|:.:||.....| .|.|.:......|.||.|||
Human   282 TKMQHENLVRLLGV-ILHQGLYIVMEHVSKGNLVNFLRTRGRALVNTAQLLQFSLHVAEGMEYLE 345

  Fly  1178 SKNCIHRDLAARNCLVDLEHSVKISDFGMSREEEEYIVSDGMKQIPVKWTAPEALNFGKYTSLCD 1242
            ||..:||||||||.||..:...|:||||:::.|.:.:.|   .::||||||||||..||:||..|
Human   346 SKKLVHRDLAARNILVSEDLVAKVSDFGLAKAERKGLDS---SRLPVKWTAPEALKHGKFTSKSD 407

  Fly  1243 VWSYGILMWEIFSKGDTPYSGMTNSRARERIDTGYRMPTPKSTPEEMYRLMLQCWAADAESRPHF 1307
            |||:|:|:||:||.|..||..|:.....|.::.||||..|:..|..::.||..||.|:...||.|
Human   408 VWSFGVLLWEVFSYGRAPYPKMSLKEVSEAVEKGYRMEPPEGCPGPVHVLMSSCWEAEPARRPPF 472

  Fly  1308 DEI 1310
            .::
Human   473 RKL 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 27/99 (27%)
TyrKc 1063..1311 CDD:197581 102/249 (41%)
PTKc_Fes_like 1067..1315 CDD:270637 101/245 (41%)
MATKNP_002369.2 SH3_CHK 51..109 CDD:212745
SH3 domain 55..106
SH2_csk_like 119..216 CDD:198190 32/115 (28%)
SH2 domain 123..213 32/108 (30%)
PTKc_Chk 229..482 CDD:270666 104/256 (41%)
catalytic domain 236..479 102/249 (41%)
STYKc 236..479 CDD:214568 102/249 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100013
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.