DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and pik3r2

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_997987.2 Gene:pik3r2 / 404211 ZFINID:ZDB-GENE-040309-1 Length:724 Species:Danio rerio


Alignment Length:436 Identity:88/436 - (20%)
Similarity:156/436 - (35%) Gaps:133/436 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   748 SGSDCPTNSSSSSSNNNNNNKNTSSNSN------HSASQSTI-ITSTITTTITTTTTTTPSKENS 805
            ||.||.|...:|:|:|...:.:...:.:      |:.|::.| ....:...|......|..:...
Zfish   139 SGLDCRTLYRTSASDNQRPSLSELQDLDVGQWDIHALSEAVIRYLQDLPAPIIPPCVYTDLQAAV 203

  Fly   806 RLKFKVPKIQ----------KKSKAIRNTFRSKLLNFQLKR-SKPCKQCTKRRRIHPSKSVFDFA 859
            :|:..||.::          |....::|..   .|::.|:. .|.|:..        .::..|..
Zfish   204 QLESDVPSVRRRELLQQVLDKPEVPLQNLL---TLHYLLQHLDKVCQSA--------EQNGLDIY 257

  Fly   860 KEFEVEQP-------AGSAADEQFCNCPPAG-----------QKPVKPSVQISGHKDHPFESSSG 906
            ...::..|       :||..||.|   |.|.           |:|..|::.....|         
Zfish   258 TLGQIFGPLLFRGPVSGSEEDEAF---PAAAVERLLLERIWEQEPTPPALPPKPPK--------- 310

  Fly   907 ELDENSDRDIDNDEEEEDSASDDVLSMKDHCYCVPSLAASISLSTNRPLYEEEWFHGVLPREEVV 971
                                             ..::|:|::..::..|.|.||:.|.:.||||.
Zfish   311 ---------------------------------AKAMASSVTNGSDSLLSEAEWYWGDISREEVN 342

  Fly   972 RLLNN--DGDFLVRETIRNEESQIVLSVCWNGHKHFIVQTTGEGNFRFEGP-PFASIQELIMH-- 1031
            ..:.:  ||.||||:.......:..|::...|:...|......|.:.|..| .|.|:.|||.|  
Zfish   343 EKMRDTPDGTFLVRDASSKVHGEYTLTLRKGGNNKLIKIFHRGGKYGFSEPLTFLSVVELINHYR 407

  Fly  1032 -----QYHSEL------PVT-------VKSGAI----LRRPVCRERW-ELSNDDVVLLERIGRGN 1073
                 ||:::|      ||:       ||..:|    .:..|..|:: |.|.:..||.|...|.:
Zfish   408 HESLAQYNAKLDSHLLFPVSKYQQDQVVKEDSIEAVGEQLKVYHEQYQEKSREYDVLYEEYTRSS 472

  Fly  1074 FGDVYKAKLKSTKLDVAVKTCRM---------TLPDEQKRKFLQEG 1110
                .:.::|.|.::...:|.::         .|..:...||.:||
Zfish   473 ----QELQMKRTAIEAFNETIKIFEEQCETQERLSRDSIEKFRREG 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 30/101 (30%)
TyrKc 1063..1311 CDD:197581 12/57 (21%)
PTKc_Fes_like 1067..1315 CDD:270637 10/53 (19%)
pik3r2NP_997987.2 SH3_PI3K_p85beta 6..79 CDD:212842
RhoGAP 113..298 CDD:295372 31/172 (18%)
SH2_nSH2_p85_like 326..433 CDD:198195 32/106 (30%)
PI3K_P85_iSH2 437..596 CDD:293063 17/82 (21%)
iSH2_PIK3R2 438..598 CDD:214019 17/81 (21%)
SH2_cSH2_p85_like 616..720 CDD:198184
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.