powered by:
Protein Alignment FER and GRAPL
DIOPT Version :9
Sequence 1: | NP_524288.3 |
Gene: | FER / 41118 |
FlyBaseID: | FBgn0000723 |
Length: | 1325 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_016880124.1 |
Gene: | GRAPL / 400581 |
HGNCID: | 37240 |
Length: | 144 |
Species: | Homo sapiens |
Alignment Length: | 52 |
Identity: | 14/52 - (26%) |
Similarity: | 27/52 - (51%) |
Gaps: | 13/52 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 960 WFHGVLPR---EEVVRLLNNDGDFLVRE----------TIRNEESQIVLSVC 998
|:.|.:.| ||::...|:.|.||:|| :::.|.|.::::.|
Human 60 WYSGRISRQLAEEILMKRNHLGAFLIRESESSPGEFSVSVKLECSGVIMAHC 111
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000006 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.