DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and LIMK2

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_001026971.1 Gene:LIMK2 / 3985 HGNCID:6614 Length:686 Species:Homo sapiens


Alignment Length:276 Identity:75/276 - (27%)
Similarity:131/276 - (47%) Gaps:47/276 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1062 DVVLLERIGRGNFGDVYKAKLKSTKLDVAVKTCRMTLPDEQKRKFLQEGRILKQYDHPNIVKLIG 1126
            |::..|.:|:|.||...|...|:|...:.:|.. :...:|.::.||.|.::::..||||::|.||
Human   309 DLIHGEVLGKGFFGQAIKVTHKATGKVMVMKEL-IRCDEETQKTFLTEVKVMRSLDHPNVLKFIG 372

  Fly  1127 ICVQKQPIMIVMELVLGGSLLTYLRKNSNGLTTRQQMGMCRDAAAGMRYLESKNCIHRDLAARNC 1191
            :..:.:.:.::.|.:.||:|..:|| :.:....:|::...:..|:||.||.|...|||||.:.||
Human   373 VLYKDKKLNLLTEYIEGGTLKDFLR-SMDPFPWQQKVRFAKGIASGMAYLHSMCIIHRDLNSHNC 436

  Fly  1192 LVDLEHSVKISDFGMSREEEEYIVSDGMKQIPVK-------------------------WTAPEA 1231
            |:.|:.:|.::|||:||     ::.:..|:.|::                         |.|||.
Human   437 LIKLDKTVVVADFGLSR-----LIVEERKRAPMEKATTKKRTLRKNDRKKRYTVVGNPYWMAPEM 496

  Fly  1232 LNFGKYTSLCDVWSYGILMWEIFSK--GDTPYSGMTNSRARERIDTGYRMP------TPKSTPEE 1288
            ||...|....|::|:||::.||..:  .|......|       :|.|..:.      .|...|..
Human   497 LNGKSYDETVDIFSFGIVLCEIIGQVYADPDCLPRT-------LDFGLNVKLFWEKFVPTDCPPA 554

  Fly  1289 MYRLMLQCWAADAESR 1304
            .:.|...|...:.|||
Human   555 FFPLAAICCRLEPESR 570

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581 74/275 (27%)
PTKc_Fes_like 1067..1315 CDD:270637 74/271 (27%)
LIMK2NP_001026971.1 LIM <15..44 CDD:295319
LIM2_LIMK2 46..104 CDD:188849
PDZ 131..215 CDD:278991
PKc_like 316..570 CDD:328722 71/267 (27%)
PP1_inhibitor 564..686 CDD:283108 3/7 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.