DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and Tak1

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster


Alignment Length:263 Identity:81/263 - (30%)
Similarity:131/263 - (49%) Gaps:15/263 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly  1062 DVVLLERIGRGNFGDVYKAKLKSTKLDVAVKTCRMTLPDEQKRKFLQEGRILKQYDHPNIVKLIG 1126
            ::.|.|::|.|::|.|.||..:. || ||||.   .....:::...:|.:.|.:..||||:.|.|
  Fly    18 EITLREKVGHGSYGVVCKAVWRD-KL-VAVKE---FFASAEQKDIEKEVKQLSRVKHPNIIALHG 77

  Fly  1127 ICVQKQPIMIVMELVLGGSLLTYLR-KNSNGLTTRQQMGMCRDAAAGMRYLES---KNCIHRDLA 1187
            |...:|...::||...||||..:|. |.....:....|...|..|.|:.||.:   |..||||:.
  Fly    78 ISSYQQATYLIMEFAEGGSLHNFLHGKVKPAYSLAHAMSWARQCAEGLAYLHAMTPKPLIHRDVK 142

  Fly  1188 ARNCLV-DLEHSVKISDFGMSREEEEYIVSDGMKQIPVKWTAPEALNFGKYTSLCDVWSYGILMW 1251
            ..|.|: :...::||.|||...::...:.::   :....|.|||.....|||..||::|:.|::|
  Fly   143 PLNLLLTNKGRNLKICDFGTVADKSTMMTNN---RGSAAWMAPEVFEGSKYTEKCDIFSWAIVLW 204

  Fly  1252 EIFSKGDTPYSGMTNSRARE-RIDTGYRMPTPKSTPEEMYRLMLQCWAADAESRPHFDEIYNVVD 1315
            |:.|: ..|:.|:.|:...: :|..|.|.|...:.|:.:..||..||....|.||....|..|:.
  Fly   205 EVLSR-KQPFKGIDNAYTIQWKIYKGERPPLLTTCPKRIEDLMTACWKTVPEDRPSMQYIVGVMH 268

  Fly  1316 ALI 1318
            .::
  Fly   269 EIV 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581 79/253 (31%)
PTKc_Fes_like 1067..1315 CDD:270637 80/253 (32%)
Tak1NP_524080.1 TyrKc 19..264 CDD:197581 79/253 (31%)
STKc_TAK1 25..275 CDD:270960 79/256 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.