DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and PVRAP

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_729124.1 Gene:PVRAP / 38677 FlyBaseID:FBgn0052406 Length:474 Species:Drosophila melanogaster


Alignment Length:429 Identity:88/429 - (20%)
Similarity:136/429 - (31%) Gaps:169/429 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   747 SSGSDCPT-NSSSSSSNNNNN-------NKNTSSNSN-HSASQSTIITSTITTTITTTTTTTPSK 802
            ||.:..|| ::|:|:||:|:|       |:|.:|||| :|.|......:.|...:....|     
  Fly    53 SSSNSSPTADNSNSNSNSNSNANINRNLNQNPNSNSNTNSNSYFNRFDNRIAANLAAVLT----- 112

  Fly   803 ENSRLKFKVPKIQKKSKA-IRN--TFRSKLLNFQLKRS---KPCKQCTKRRR-----IHPSKSVF 856
             .:..:|:......:..| :.|  ..||.|.....|.|   .|......|||     .|.:.:..
  Fly   113 -GAGARFRSSSCSNRHPAGVANPAVLRSPLATISRKTSLATPPSPASLGRRRPLQLFTHANLNCN 176

  Fly   857 DFAKEFEVEQPAGSAADE---QFCNCPPAGQKP--------------------VKPSVQISGHKD 898
            |..|   |.|...|..|.   :..:|.....||                    |.....:|...|
  Fly   177 DNEK---VAQTPSSDEDNSPTELNSCKRLADKPPLVKRLTMGLLRQNEESRPLVGDMTPLSAPLD 238

  Fly   899 HPFESSSGELDENSDRDI----------------------DNDE--------EEEDSAS------ 927
            .....|:|.::|:|..|.                      ||:|        .|..||:      
  Fly   239 IQPVYSNGYINEDSYIDSKFGDSCRQSLTAIPMLDNVNLNDNNEFNLKKRYLRETSSANSSPKIF 303

  Fly   928 ----------------------------DDVLSMKDHCYCVPSLAASISLSTNRPLYEEEWFHGV 964
                                        ::.|.:||.|                      |:...
  Fly   304 ANRLRMNQGAVGQRCSSLANAFGNVGSDEEDLELKDAC----------------------WYQAG 346

  Fly   965 LPREEVVRLL--NNDGDFLVRE----------TIRNEESQIVLSVCWNGHK--HFIVQTTGEG-- 1013
            :.|:..|.:|  .:.|.||||:          |:|.....        |.|  ::|:..:..|  
  Fly   347 ISRDIAVEVLQSKSPGAFLVRKSSSKPGCYALTLRVPSPP--------GPKIANYIILRSPRGYK 403

  Fly  1014 --NFRFEGPPFASIQELIMHQYHSELPVTVKSGAILRRP 1050
              .||.|   |:|::.||.|  ||.:|..:.....:.||
  Fly   404 IKGFRKE---FSSLKALITH--HSVMPELLPVPLAMPRP 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 25/103 (24%)
TyrKc 1063..1311 CDD:197581
PTKc_Fes_like 1067..1315 CDD:270637
PVRAPNP_729124.1 SH2 342..435 CDD:301589 26/105 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.