DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and Ack

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_647859.1 Gene:Ack / 38489 FlyBaseID:FBgn0028484 Length:1073 Species:Drosophila melanogaster


Alignment Length:421 Identity:115/421 - (27%)
Similarity:193/421 - (45%) Gaps:89/421 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   957 EEEWFHGVLPREEVVRLLNNDGDFLVRETIRNEESQIVLSVCWNGHKHFI----VQTTGEGNFRF 1017
            |..|...:|...::.:.|         :.||::     |.|....|..::    ::..|.|.   
  Fly    14 ETAWLEDLLREVQLEQFL---------DRIRDD-----LQVTRLAHFDYVLPDDLERCGLGK--- 61

  Fly  1018 EGPPFASIQELI----MHQYHSEL----------PVTVKSGAILRRPVCRERWELS----NDDVV 1064
              |....:.|.:    .||:...:          |.:.|..:..|........:|:    ..|:.
  Fly    62 --PAIRRLMEAVRKKKAHQWRKNILSKLIGGGKQPSSKKQSSAARESSQGNGTQLTCLIHEKDIT 124

  Fly  1065 LLERIGRGNFGDVYKAKLKSTK----LDVAVKTCR---MTLP---DEQKRKFLQEGRILKQYDHP 1119
            :..::|.|:||.|.:.:..::.    :.||||..:   :|.|   |:    |.:|.:.:...||.
  Fly   125 MGLKLGDGSFGVVRRGEWSASPAGKVIPVAVKVLKSDNLTQPGIIDD----FFREVQAMHALDHA 185

  Fly  1120 NIVKLIGICVQKQPIMIVMELVLGGSLLTYLRKNSNGLTTRQQMGMCRDAA------------AG 1172
            |:|:|.|: |..||:|::.||...||||..|||            .||..:            .|
  Fly   186 NLVRLYGV-VLSQPMMMITELAERGSLLDTLRK------------QCRHTSLTIIWNWSVQIVTG 237

  Fly  1173 MRYLESKNCIHRDLAARNCLVDLEHSVKISDFGMSR----EEEEYIVSDGMKQIPVKWTAPEALN 1233
            |.|||.|..:|||||.||.|:...:.:||.|||:.|    |::.|::|: .|::|..|.|||:|.
  Fly   238 MAYLEQKRFLHRDLACRNVLLAAGNKIKIGDFGLMRALPQEDDCYVMSE-HKKVPFPWCAPESLR 301

  Fly  1234 FGKYTSLCDVWSYGILMWEIFSKGDTPYSGMTNSRARERID-TGYRMPTPKSTPEEMYRLMLQCW 1297
            |.:::...|.|.:|:.:||:||.|:.|:.|:..|:...:|| .|.|:..|.:.|.::|.:|||||
  Fly   302 FRQFSHASDTWMFGVTLWEMFSFGEDPWVGLNGSQILRKIDREGERLHQPDACPPDVYAMMLQCW 366

  Fly  1298 AADAESRPHFDEIYNVVDAL---ILRLDNSH 1325
            ......||.|..:...:.::   ::|...||
  Fly   367 DKTPAERPTFAALKEYLASMSPPVMRASRSH 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 15/99 (15%)
TyrKc 1063..1311 CDD:197581 92/274 (34%)
PTKc_Fes_like 1067..1315 CDD:270637 92/274 (34%)
AckNP_647859.1 SAM_TNK-like 14..75 CDD:188938 13/79 (16%)
PTKc_Ack_like 128..385 CDD:270636 92/274 (34%)
UBA_TNK1 1031..1070 CDD:270513
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468369
Domainoid 1 1.000 165 1.000 Domainoid score I1208
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24418
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.