DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and egfra

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_919405.1 Gene:egfra / 378478 ZFINID:ZDB-GENE-030918-1 Length:1191 Species:Danio rerio


Alignment Length:250 Identity:88/250 - (35%)
Similarity:147/250 - (58%) Gaps:11/250 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly  1069 IGRGNFGDVYKA----KLKSTKLDVAVKTCRMTLPDEQKRKFLQEGRILKQYDHPNIVKLIGICV 1129
            :|.|.||.|:|.    :.::.|:.||:|..|.....:..::.:.|..::...:||::.:|:|||:
Zfish   717 LGSGAFGTVHKGLWVPEGENVKIPVAIKVLREATSPKANKEIMDEAYVMASVEHPHVCRLLGICL 781

  Fly  1130 QKQPIMIVMELVLGGSLLTYLRKNSNGLTTRQQMGMCRDAAAGMRYLESKNCIHRDLAARNCLVD 1194
             ...:.::.:|:..|.||.|:|:|.:.:.::..:..|...|.||.|||.::.:||||||||.||.
Zfish   782 -TSTVQLITQLMPYGCLLDYVRENKDRIGSQHLLNWCVQIAKGMNYLEERHLVHRDLAARNVLVK 845

  Fly  1195 LEHSVKISDFGMSR----EEEEYIVSDGMKQIPVKWTAPEALNFGKYTSLCDVWSYGILMWEIFS 1255
            ....|||:|||:::    :|:||....|  ::|:||.|.|::....||...||||||:.:||:.:
Zfish   846 TPQHVKITDFGLAKLLNADEKEYHADGG--KVPIKWMALESIQHRTYTHQSDVWSYGVTVWELMT 908

  Fly  1256 KGDTPYSGMTNSRARERIDTGYRMPTPKSTPEEMYRLMLQCWAADAESRPHFDEI 1310
            .|..||.|:..|.....::.|.|:|.|.....::|.:|::||..||||||.|.|:
Zfish   909 FGTKPYDGIPASEIAGVLEKGERLPQPPICTIDVYMIMVKCWMIDAESRPRFREL 963

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581 88/249 (35%)
PTKc_Fes_like 1067..1315 CDD:270637 88/249 (35%)
egfraNP_919405.1 Recep_L_domain 54..166 CDD:279382
Furin-like 184..333 CDD:279142
FU 229..274 CDD:238021
Recep_L_domain 359..479 CDD:279382
GF_recep_IV 503..634 CDD:291509
FU 550..596 CDD:214589
PTKc_EGFR 703..1014 CDD:270683 88/249 (35%)
Pkinase_Tyr 711..967 CDD:285015 88/249 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.