DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and Egfr

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_476759.1 Gene:Egfr / 37455 FlyBaseID:FBgn0003731 Length:1426 Species:Drosophila melanogaster


Alignment Length:532 Identity:129/532 - (24%)
Similarity:213/532 - (40%) Gaps:153/532 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   840 CKQCT--KRRRIHPSKSVFDFAKEFEVEQPAGSAADEQFCNCPPAGQKPVKPSVQISGHKDHP-F 901
            |.:||  |||            ::.|.|.||....||:...|                .:.|| .
  Fly   757 CSKCTHYKRR------------EQCETECPADHYTDEEQREC----------------FQCHPEC 793

  Fly   902 ESSSGELDENSDRDIDNDEEEEDSASDDVLSMKDHCYCVPSLAASISLSTNRPLYEEEWFHGVLP 966
            ...:|                  ..:||..|.:                 |..|::         
  Fly   794 NGCTG------------------PGADDCKSCR-----------------NFKLFD--------- 814

  Fly   967 REEVVRLLNNDGDFLVRETIRNEESQIVLSVCWNGHKHFIVQTTGEGNFRFEGPPFASIQELIMH 1031
                   .|..|.: |..|:.|..|:..|.:     :|...|.|..|.:....||.:|       
  Fly   815 -------ANETGPY-VNSTMFNCTSKCPLEM-----RHVNYQYTAIGPYCAASPPRSS------- 859

  Fly  1032 QYHSELPVT---VKSGAILRRP---------VCRERWELSNDDVVL------------------- 1065
            :..:.|.|.   :.:||:|...         :||::.:...:.|.:                   
  Fly   860 KITANLDVNMIFIITGAVLVPTICILCVVTYICRQKQKAKKETVKMTMALSGCEDSEPLRPSNIG 924

  Fly  1066 -------------LER---IGRGNFGDVYKA----KLKSTKLDVAVKTCRMTLPDEQKRKFLQEG 1110
                         |.:   :|.|.||.|||.    :.::.|:.||:|....:...|...:||:|.
  Fly   925 ANLCKLRIVKDAELRKGGVLGMGAFGRVYKGVWVPEGENVKIPVAIKELLKSTGAESSEEFLREA 989

  Fly  1111 RILKQYDHPNIVKLIGICVQKQPIMIVMELVLGGSLLTYLRKNSNGLTTRQQMGMCRDAAAGMRY 1175
            .|:...:|.|::||:.:|:..| :|::.:|:..|.||.|:|.|.:.:.::..:......|.||.|
  Fly   990 YIMASVEHVNLLKLLAVCMSSQ-MMLITQLMPLGCLLDYVRNNRDKIGSKALLNWSTQIAKGMSY 1053

  Fly  1176 LESKNCIHRDLAARNCLVDLEHSVKISDFG----MSREEEEYIVSDGMKQIPVKWTAPEALNFGK 1236
            ||.|..:||||||||.||.....|||:|||    :|.:..||..:.|  ::|:||.|.|.:....
  Fly  1054 LEEKRLVHRDLAARNVLVQTPSLVKITDFGLAKLLSSDSNEYKAAGG--KMPIKWLALECIRNRV 1116

  Fly  1237 YTSLCDVWSYGILMWEIFSKGDTPYSGMTNSRARERIDTGYRMPTPKSTPEEMYRLMLQCWAADA 1301
            :||..|||::|:.:||:.:.|..|:..:......:.|:.|.::..|:....::|..:|.||..||
  Fly  1117 FTSKSDVWAFGVTIWELLTFGQRPHENIPAKDIPDLIEVGLKLEQPEICSLDIYCTLLSCWHLDA 1181

  Fly  1302 ESRPHFDEIYNV 1313
            ..||.|.::..|
  Fly  1182 AMRPTFKQLTTV 1193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 16/85 (19%)
TyrKc 1063..1311 CDD:197581 86/290 (30%)
PTKc_Fes_like 1067..1315 CDD:270637 85/258 (33%)
EgfrNP_476759.1 Recep_L_domain 419..547 CDD:279382
GF_recep_IV 572..684 CDD:291509
FU 573..>606 CDD:238021
FU 617..659 CDD:214589
FU 662..716 CDD:214589
FU 739..786 CDD:238021 12/40 (30%)
FU 784..834 CDD:214589 15/117 (13%)
PTKc_EGFR_like 930..1208 CDD:270648 86/267 (32%)
STYKc 938..1194 CDD:214568 86/259 (33%)
Recep_L_domain 128..239 CDD:279382
Furin-like 253..401 CDD:279142
FU 255..292 CDD:214589
FU 302..345 CDD:238021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 165 1.000 Domainoid score I1208
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.