DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and ripk2

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_919392.2 Gene:ripk2 / 373874 ZFINID:ZDB-GENE-030902-3 Length:584 Species:Danio rerio


Alignment Length:293 Identity:80/293 - (27%)
Similarity:136/293 - (46%) Gaps:46/293 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1066 LERIGRGNFGDVYKAKLKSTKLDVAVKTCRMTLP--DEQKRKFLQEGRILKQYDHPNIVKLIGIC 1128
            |..|.:|.||.|::|:....:..||:|..::..|  :.::...|:|..:|.:....:|:::.|:|
Zfish    31 LHYISKGGFGTVFRAQHSDWRTTVAIKCLKLDSPVGERERNCLLKEAEVLHKARFNHIIQIFGVC 95

  Fly  1129 VQKQPIMIVMELVLGGSLLTYLRKNS--NGLTTRQQMGMCRDAAAGMRYLE--SKNCIHRDLAAR 1189
            .:.:...|:.|.:..|||...|.:..  ..:....::.:..:.|.|:.:|.  |...:|.||..:
Zfish    96 NEPEFFCIITEYMTNGSLDELLHEKDIYPAVAWPLRLRILYEIALGVNFLHNMSPPLLHHDLKTQ 160

  Fly  1190 NCLVDLEHSVKISDFGMSREEEEYIV-SDGMKQIPVKWTA----PEALNFG-------KYTSLCD 1242
            |.|:|.|:.|||:|||:|:..:..|. ..|.|...:..|.    ||.....       ||    |
Zfish   161 NILMDGEYHVKIADFGLSKWRQLSITKGSGSKPAEMGGTVIYMPPEEYEPSKTRRTDVKY----D 221

  Fly  1243 VWSYGILMWEIFSKGDTPYSGMTN------SRAR-ERIDTGY-RMPTPKSTPEEMYRLMLQCWAA 1299
            ::||.|:|||:.|: ..|:...||      |..| .|.|||. .:|....:.|.:..||...|.|
Zfish   222 MYSYAIIMWEVLSR-RIPFEEATNPMQIMFSVLRGARPDTGLDSLPVDIPSRETLINLMTSGWTA 285

  Fly  1300 DAESRP--------------HFDEIYNVVDALI 1318
            :.:.||              .|||| :|::|::
Zfish   286 NPDERPSFLHCLIELEPMLRRFDEI-DVLEAVL 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581 77/284 (27%)
PTKc_Fes_like 1067..1315 CDD:270637 78/287 (27%)
ripk2NP_919392.2 STKc_RIP2 30..313 CDD:270928 78/287 (27%)
S_TKc 34..297 CDD:214567 73/267 (27%)
CARD_RIP2_CARD3 471..557 CDD:176764
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100013
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.