DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and JAK2

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_001309123.1 Gene:JAK2 / 3717 HGNCID:6192 Length:1132 Species:Homo sapiens


Alignment Length:423 Identity:118/423 - (27%)
Similarity:188/423 - (44%) Gaps:102/423 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   948 SLSTNRPL--YEE-------EWFHGVLPREEVVRLLNNDGDFLVRETIRNEESQIVLSVCWNGHK 1003
            :|.:.|.|  ||:       :|       .|:..|:||..|:                       
Human   756 ALDSQRKLQFYEDRHQLPAPKW-------AELANLINNCMDY----------------------- 790

  Fly  1004 HFIVQTTGEGNFRFEGPPFASI----QELIMHQY----HSELPVTVKSGAI-------LRRPVCR 1053
                    |.:||   |.|.:|    ..|....|    .:::...::.||:       .|.|...
Human   791 --------EPDFR---PSFRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRDPTQF 844

  Fly  1054 ERWELSNDDVVLLERIGRGNFGDV----YKAKLKSTKLDVAVKTCRMTLPDEQKRKFLQEGRILK 1114
            |...|.     .|:::|:||||.|    |.....:|...||||..:.: .:|..|.|.:|..|||
Human   845 EERHLK-----FLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHS-TEEHLRDFEREIEILK 903

  Fly  1115 QYDHPNIVKLIGICVQ--KQPIMIVMELVLGGSLLTYLRKNSNGLTTRQQMGMCRDAAAGMRYLE 1177
            ...|.||||..|:|..  ::.:.::||.:..|||..||:|:...:...:.:........||.||.
Human   904 SLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLG 968

  Fly  1178 SKNCIHRDLAARNCLVDLEHSVKISDFGMSR---EEEEYIVSDGMKQIPVKWTAPEALNFGKYTS 1239
            :|..||||||.||.||:.|:.|||.|||:::   :::||.......:.|:.|.|||:|...|::.
Human   969 TKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYAPESLTESKFSV 1033

  Fly  1240 LCDVWSYGILMWEIFS---KGDTP---YSGMTNSRAR---------ERIDTGYRMPTPKSTPEEM 1289
            ..||||:|::::|:|:   |..:|   :..|..:..:         |.:....|:|.|...|:|:
Human  1034 ASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEI 1098

  Fly  1290 YRLMLQCWAADAESRPHFDEIYNVVDALILRLD 1322
            |.:|.:||..:...||.|.:       |.||:|
Human  1099 YMIMTECWNNNVNQRPSFRD-------LALRVD 1124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 18/102 (18%)
TyrKc 1063..1311 CDD:197581 89/271 (33%)
PTKc_Fes_like 1067..1315 CDD:270637 88/271 (32%)
JAK2NP_001309123.1 Interaction with cytokine/interferon/growth hormone receptors. /evidence=ECO:0000250 1..239
B41 38..270 CDD:214604
FERM_C_JAK2 266..386 CDD:270141
SH2_Jak2 386..482 CDD:198242
PTK_Jak2_rpt1 545..806 CDD:270663 17/90 (19%)
Pkinase_Tyr 545..805 CDD:285015 17/89 (19%)
PTKc_Jak2_rpt2 844..1127 CDD:271107 95/294 (32%)
TyrKc 849..1119 CDD:197581 90/282 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100013
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.