DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and Ptk6

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_001102438.1 Gene:Ptk6 / 366275 RGDID:1309098 Length:451 Species:Rattus norvegicus


Alignment Length:391 Identity:135/391 - (34%)
Similarity:208/391 - (53%) Gaps:24/391 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   949 LSTNRPLYEEEWFHGVLPREEVVRLLNND----GDFLVRETIRNEESQIVLSVCWNGH--KHFIV 1007
            |:....:..|.||.|.:.|.|.:..|.::    |.||:|.: :...:..|||| |:..  :|:.:
  Rat    67 LAEKETVESEPWFFGCISRSEAMHRLQSEDYPKGTFLIRVS-QKPGADYVLSV-WDAEAVRHYRI 129

  Fly  1008 QTTGEGNFRF-EGPPFASIQELI-MHQYHSELP---VTVKSGAILRRPVCR-ERWELSNDDVVLL 1066
            .....|.... |...|:|:.||: .|:.|:..|   :::....:...|:.. :.||...::..|.
  Rat   130 WRNSAGRLHLNEVVSFSSLSELVNYHKTHNLSPGLQLSMACWKLKTEPLPHWDDWERPREEFTLC 194

  Fly  1067 ERIGRGNFGDVYKAKLKSTKLDVAVKT-CRMTLPDEQKRKFLQEGRILKQYDHPNIVKLIGICVQ 1130
            :::|.|.||:|::...|.. :.||||. .|..|  ..:..|..|.:.:|:..|.:|:.|..:...
  Rat   195 KKLGSGYFGEVFEGLWKGL-VRVAVKVISRDNL--LHQHTFQAEIQAMKKLRHKHILSLYAVATA 256

  Fly  1131 KQPIMIVMELVLGGSLLTYLR-KNSNGLTTRQQMGMCRDAAAGMRYLESKNCIHRDLAARNCLVD 1194
            ..|:.|:.||:..||||..|| .:...|...:.:......|.||.||||:|.|||||||||.||.
  Rat   257 GDPVYIITELMPKGSLLQLLRDSDEKDLPILELVDFASQVAEGMCYLESQNYIHRDLAARNVLVT 321

  Fly  1195 LEHSVKISDFGMSR--EEEEYIVSDGMKQIPVKWTAPEALNFGKYTSLCDVWSYGILMWEIFSKG 1257
            ..:..|:.|||::|  :|:.|:..|  ..:|.||||||||:.|.|:...||||:|:|:.||||:|
  Rat   322 ENNLCKVGDFGLARLVKEDIYLSRD--HNVPYKWTAPEALSRGHYSIKSDVWSFGVLLHEIFSRG 384

  Fly  1258 DTPYSGMTNSRARERIDTGYRMPTPKSTPEEMYRLMLQCWAADAESRPHFDEIYNVVDALILRLD 1322
            ..||.||:|.....|:|.|||||.|...|..:::|||.||:.|.:.||.|.::...:.. |.|.:
  Rat   385 QMPYPGMSNHETFLRVDAGYRMPCPLECPPNIHKLMLSCWSRDPKQRPCFKDLCEKLSG-ITRYE 448

  Fly  1323 N 1323
            |
  Rat   449 N 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 26/96 (27%)
TyrKc 1063..1311 CDD:197581 102/251 (41%)
PTKc_Fes_like 1067..1315 CDD:270637 101/251 (40%)
Ptk6NP_001102438.1 SH3_Brk 12..69 CDD:212781 1/1 (100%)
SH2_PTK6_Brk 75..174 CDD:198221 26/100 (26%)
PKc_like 184..444 CDD:304357 104/265 (39%)
STYKc 192..441 CDD:214568 102/253 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.