DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and drk

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster


Alignment Length:200 Identity:48/200 - (24%)
Similarity:81/200 - (40%) Gaps:49/200 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   899 HPFESSSGELDENSDR--------DIDND--------EEEEDSASDDVLSMKDHCYCVPSLAASI 947
            |.|.:::.  ||.|.|        ::::|        :.:|.....:.:.||:|           
  Fly     7 HDFSATAD--DELSFRKTQILKILNMEDDSNWYRAELDGKEGLIPSNYIEMKNH----------- 58

  Fly   948 SLSTNRPLYEEEWFHGVLPREEVVRLLNN--DGDFLVRETIRNEESQIVLSV-CWNGHKHFIVQT 1009
                       :|::|.:.|.:..:||:|  :|.||:|.: .:......||| |.:|.:||.|..
  Fly    59 -----------DWYYGRITRADAEKLLSNKHEGAFLIRIS-ESSPGDFSLSVKCPDGVQHFKVLR 111

  Fly  1010 TGEGNFRFEGPPFASIQELIMHQYHSELPVTVKSGAILRRPVCRERWELSNDDVVLLERIGRGNF 1074
            ..:..|......|.|:.||:  :||....|:......||..:..|....:..|.|..|. |..:|
  Fly   112 DAQSKFFLWVVKFNSLNELV--EYHRTASVSRSQDVKLRDMIPEEMLVQALYDFVPQES-GELDF 173

  Fly  1075 --GDV 1077
              |||
  Fly   174 RRGDV 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 25/88 (28%)
TyrKc 1063..1311 CDD:197581 6/16 (38%)
PTKc_Fes_like 1067..1315 CDD:270637 5/12 (42%)
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 8/47 (17%)
SH2_Grb2_like 56..149 CDD:199828 29/117 (25%)
SH3_GRB2_like_C 156..208 CDD:212739 7/23 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.