Sequence 1: | NP_524288.3 | Gene: | FER / 41118 | FlyBaseID: | FBgn0000723 | Length: | 1325 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_476858.1 | Gene: | drk / 36497 | FlyBaseID: | FBgn0004638 | Length: | 211 | Species: | Drosophila melanogaster |
Alignment Length: | 200 | Identity: | 48/200 - (24%) |
---|---|---|---|
Similarity: | 81/200 - (40%) | Gaps: | 49/200 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 899 HPFESSSGELDENSDR--------DIDND--------EEEEDSASDDVLSMKDHCYCVPSLAASI 947
Fly 948 SLSTNRPLYEEEWFHGVLPREEVVRLLNN--DGDFLVRETIRNEESQIVLSV-CWNGHKHFIVQT 1009
Fly 1010 TGEGNFRFEGPPFASIQELIMHQYHSELPVTVKSGAILRRPVCRERWELSNDDVVLLERIGRGNF 1074
Fly 1075 --GDV 1077 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
FER | NP_524288.3 | F-BAR_Fes_Fer | 7..243 | CDD:153341 | |
SH2_Fps_family | 953..1039 | CDD:198224 | 25/88 (28%) | ||
TyrKc | 1063..1311 | CDD:197581 | 6/16 (38%) | ||
PTKc_Fes_like | 1067..1315 | CDD:270637 | 5/12 (42%) | ||
drk | NP_476858.1 | SH3_GRB2_like_N | 2..53 | CDD:212738 | 8/47 (17%) |
SH2_Grb2_like | 56..149 | CDD:199828 | 29/117 (25%) | ||
SH3_GRB2_like_C | 156..208 | CDD:212739 | 7/23 (30%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000006 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |