DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and Drl-2

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_001286371.1 Gene:Drl-2 / 36436 FlyBaseID:FBgn0033791 Length:648 Species:Drosophila melanogaster


Alignment Length:313 Identity:88/313 - (28%)
Similarity:136/313 - (43%) Gaps:39/313 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly  1009 TTGEGNFR-FEGPPFASIQELIMHQYHSELPVTVKSGAILRRPVCRERWELSNDDVVLLERIGRG 1072
            |:|.|:.. |.|.|..|   .|....|.|     |....|||....:...||.:::|     ..|
  Fly   339 TSGSGSLSLFGGIPTGS---TITMASHGE-----KGNQRLRRITSVQPGALSYEELV-----KEG 390

  Fly  1073 NFGDVYKAKLKSTKLDVAVKTCRMTLPDEQKRKFLQEGRILKQYDHPNIVKLIGICVQKQPIMIV 1137
            .||.:|..|| ....:..|||........|....||:..:|....|.:|:         .|::..
  Fly   391 TFGRIYAGKL-GESCEALVKTVIDGASLTQVACLLQDASLLIGVSHQHIL---------APLLAN 445

  Fly  1138 MEL----------VLGGSLLTYL---RKNSNGLTTRQQMGMCRDAAAGMRYLESKNCIHRDLAAR 1189
            .||          ...|:|..||   |::|..|:|||.:........|:.||.|...:|:|:|.|
  Fly   446 TELPGPPEIAYPHPSKGNLKMYLQKSRESSTALSTRQLVEFGLHITKGLAYLHSLGIVHKDIATR 510

  Fly  1190 NCLVDLEHSVKISDFGMSRE--EEEYIVSDGMKQIPVKWTAPEALNFGKYTSLCDVWSYGILMWE 1252
            ||.:|.|..|||.|..:||:  .::|......:..|:||.:.|:|....|.:..|||:.|:..||
  Fly   511 NCYLDEESYVKICDSALSRDLFPDDYDCLGDNENRPLKWLSLESLQKRVYATQGDVWALGVTYWE 575

  Fly  1253 IFSKGDTPYSGMTNSRARERIDTGYRMPTPKSTPEEMYRLMLQCWAADAESRP 1305
            :.:....|:..:........:..|:|:..|.:.|:|.:.:|..||..:|:.||
  Fly   576 LVTLAQMPHEEVDIFELTNYLAAGFRLEQPVNCPDEFFTVMNCCWHCEAKQRP 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 10/30 (33%)
TyrKc 1063..1311 CDD:197581 72/258 (28%)
PTKc_Fes_like 1067..1315 CDD:270637 71/254 (28%)
Drl-2NP_001286371.1 WIF 37..156 CDD:280237
PTK_Ryk 373..644 CDD:270639 74/271 (27%)
STYKc 389..637 CDD:214568 71/250 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.