DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and dnt

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_001260567.1 Gene:dnt / 35207 FlyBaseID:FBgn0024245 Length:584 Species:Drosophila melanogaster


Alignment Length:287 Identity:84/287 - (29%)
Similarity:137/287 - (47%) Gaps:26/287 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  1030 MHQYHSELPVTVKSGAILRRPVCRERWELSNDDVVLLERIGRGNFGDVYKAKLKSTKLDVAVKTC 1094
            :|:..|||  ||:.        ||.|         |...:..|.||.||:.....|: ||.|||.
  Fly   303 LHRRISEL--TVER--------CRVR---------LSSLLQEGTFGRVYRGTYNDTQ-DVLVKTV 347

  Fly  1095 RMTLPDEQKRKFLQEGRILKQYDHPNIVKLIGICVQKQPIMIVMELVLGG--SLLTYLRKN--SN 1155
            .......|....||||.:|....||.|:.::|:.::......|:...|..  :|..:|...  :.
  Fly   348 AQHASQMQVLLLLQEGMLLYGASHPGILSVLGVSIEDHTTPFVLYPALNNTRNLKQFLLDPACAR 412

  Fly  1156 GLTTRQQMGMCRDAAAGMRYLESKNCIHRDLAARNCLVDLEHSVKISDFGMSRE--EEEYIVSDG 1218
            .:||.|.:.|....:..:.:|.|...:|:|:|.|||::|.:..||:||..:||:  ..:|.....
  Fly   413 TVTTIQIVMMASQLSMALDHLHSHGVVHKDIATRNCVIDDQLRVKLSDSSLSRDLFPSDYNCLGD 477

  Fly  1219 MKQIPVKWTAPEALNFGKYTSLCDVWSYGILMWEIFSKGDTPYSGMTNSRARERIDTGYRMPTPK 1283
            .:..||||.:.|||...:::...|.|::|:||||:.:....||:.:........:..|||:..|.
  Fly   478 SENRPVKWMSLEALQHKQFSEASDSWAFGVLMWELCTSAKQPYAEVDPFEMEHYLKDGYRLAQPF 542

  Fly  1284 STPEEMYRLMLQCWAADAESRPHFDEI 1310
            :.|:|::.:|..|||.....||.|.::
  Fly   543 NCPDELFTIMAYCWALLPAERPTFAQL 569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 4/8 (50%)
TyrKc 1063..1311 CDD:197581 75/254 (30%)
PTKc_Fes_like 1067..1315 CDD:270637 74/250 (30%)
dntNP_001260567.1 WIF 46..182 CDD:128745
PKc_like 310..580 CDD:304357 81/280 (29%)
Pkinase_Tyr 317..573 CDD:285015 76/263 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.