DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and CG10702

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_001188841.1 Gene:CG10702 / 35181 FlyBaseID:FBgn0032752 Length:946 Species:Drosophila melanogaster


Alignment Length:329 Identity:60/329 - (18%)
Similarity:108/329 - (32%) Gaps:122/329 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LQSRAAHEALIVRQDAELRLMETMKRSIQMKAKCDKEYAISLTAVAQQGLKIDRADEMQGSLISK 71
            |::|  |.:.|:..:.||..:.|..|.::.               .:.|:.:.|    ...|.::
  Fly   388 LENR--HYSFILYDNKELSELWTPSRQLEF---------------MEGGMFMHR----NNKLCNR 431

  Fly    72 SWRSYMDELDHQAKQFKFNAEQLEVVC---------DKLTH--------LSQDKRKAR------- 112
            ..|.:.:.:.|............||.|         .|.||        .||..:|..       
  Fly   432 RMREFQNAVTHDRALDSLQTNDQEVQCSPLKLQLYVQKRTHRSVKLSWLKSQTSQKIELIHRPLL 496

  Fly   113 --KAYQEE---HAKIAARLNH-----LTDEVVRKKSEYQKHL-------------------EGYK 148
              |.|.||   .|.|..|:|.     ..|:::...:.|...|                   |.::
  Fly   497 PGKLYHEESELDAPICTRINWKRRLLFPDDLIENGTHYLFDLDDLQPDTRYVVLLRTFGNDEAHE 561

  Fly   149 ALRTRFEENYIKAPSRSGRKLDDVRDKYQKACRKL--HLT-------HNEYVLSITEAIEVEKDF 204
            |...|.|..|::.      :||..:....:..:|.  .||       |..::|::.| :..::|:
  Fly   562 AYEARSELTYVQT------ELDIPKPPLLELVKKTDSSLTVQMASHDHVSFLLTVFE-LSDDQDY 619

  Fly   205 ---RNVLLPGLLEHQQSVQESFILLWRNI---------------LQEAAQYGD--LTADKYKEIQ 249
               ||..      ||.|      .:|:::               .|:|.|:.|  ..||..::.:
  Fly   620 IEQRNYC------HQPS------YVWQDMDGPRWMAYEDYDDCCAQKAEQFEDSRFIADMREQYR 672

  Fly   250 KRID 253
            ..:|
  Fly   673 CTLD 676

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341 57/317 (18%)
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581
PTKc_Fes_like 1067..1315 CDD:270637
CG10702NP_001188841.1 Recep_L_domain 47..159 CDD:279382
Furin-like 171..297 CDD:279142
FU 210..258 CDD:238021
Recep_L_domain 328..441 CDD:279382 12/73 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468371
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.