DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and Btk29A

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_001097121.1 Gene:Btk29A / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster


Alignment Length:629 Identity:178/629 - (28%)
Similarity:285/629 - (45%) Gaps:146/629 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   764 NNNNKNTSSNSNHSASQSTIITSTITTTITTTTTTTPSKENSRLKFKVPKIQKKSKAIRNTFRSK 828
            |||..|.||.:.:|           |.:|:..::||.|:                          
  Fly   227 NNNPSNGSSPAQNS-----------TRSISPNSSTTNSQ-------------------------- 254

  Fly   829 LLNFQLKRSKPCK-------------------------QCTKRRRIHPSKSVFDFAKEFEVEQPA 868
               |.|:.:....                         .||. ..:.|..|:..|.:...:....
  Fly   255 ---FSLQHNSSGSLGGGVGGGLGGGGSLGLGGGGGGGGSCTP-TSLQPQSSLTTFKQSPTLLNGN 315

  Fly   869 GSAADEQFCNCPPAGQKPVKPSVQISGHKD-----------HPFESSSG---ELDENSDRDIDND 919
            |:..|   .|.|.....|..|:   |..||           :||::..|   .|::|::.::.:|
  Fly   316 GTLLD---ANMPGGIPTPGTPN---SKAKDNSHFVKLVVALYPFKAIEGGDLSLEKNAEYEVIDD 374

  Fly   920 EEEEDSASDDVLSMKDHCYCVPSLAASISLSTNRP-----LYEEEWFHGVLPREEVVRLL---NN 976
            .:|......|.|....:   :||       :..:|     |...||:.|.:.|:....||   :.
  Fly   375 SQEHWWKVKDALGNVGY---IPS-------NYVKPKALLGLERYEWYVGDMSRQRAESLLKQGDK 429

  Fly   977 DGDFLVRETIRNEESQIVLSVCWNGH--------KHFIVQTTGEGNFRF-EGPPFASIQELIMHQ 1032
            :|.|:||::  :.:....||:    |        ||:.::......:.. |.....:|.:||.:.
  Fly   430 EGCFVVRKS--STKGLYTLSL----HTKVPQSHVKHYHIKQNARCEYYLSEKHCCETIPDLINYH 488

  Fly  1033 YHSE--LPVTVKSGAILRRPV------CRERWELSNDDVVLLERIGRGNFGDVYKAKLKSTKLDV 1089
            .|:.  |...:||.. ..|||      ..::||:...:::|:|.:|.|.||.|.:.|.:.: :|.
  Fly   489 RHNSGGLACRLKSSP-CDRPVPPTAGLSHDKWEIHPMELMLMEELGSGQFGVVRRGKWRGS-IDT 551

  Fly  1090 AVKTCRM-TLPDEQKRKFLQEGRILKQYDHPNIVKLIGICVQKQPIMIVMELVLGGSLLTYLRKN 1153
            |||..:. |:.::.   |::|.:::.:..|||:|:|.|:|.:.:||.||.|.:..||||.|||::
  Fly   552 AVKMMKEGTMSEDD---FIEEAKVMTKLQHPNLVQLYGVCSKHRPIYIVTEYMKHGSLLNYLRRH 613

  Fly  1154 SNGLTTRQQMG----MCRDAAAGMRYLESKNCIHRDLAARNCLVDLEHSVKISDFGMSRE--EEE 1212
            ..  |....||    ||...:.||.|||..|.||||||||||||..|:.||::|||::|.  :::
  Fly   614 EK--TLIGNMGLLLDMCIQVSKGMTYLERHNYIHRDLAARNCLVGSENVVKVADFGLARYVLDDQ 676

  Fly  1213 YIVSDGMKQIPVKWTAPEALNFGKYTSLCDVWSYGILMWEIFSKGDTPYSGMTNSRARERIDTGY 1277
            |..|.|.| .|:||..||.||:.:::|..|||:||:||||||:.|..||..:.|:...||:..|.
  Fly   677 YTSSGGTK-FPIKWAPPEVLNYTRFSSKSDVWAYGVLMWEIFTCGKMPYGRLKNTEVVERVQRGI 740

  Fly  1278 RMPTPKSTPEEMYRLMLQCWAADAESRPHF----DEIYNVVDAL 1317
            .:..|||..:|:|.:|..||:...|.||.|    |::..|...|
  Fly   741 ILEKPKSCAKEIYDVMKLCWSHGPEERPAFRVLMDQLALVAQTL 784

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 23/104 (22%)
TyrKc 1063..1311 CDD:197581 107/258 (41%)
PTKc_Fes_like 1067..1315 CDD:270637 107/258 (41%)
Btk29ANP_001097121.1 PH_Btk 44..222 CDD:269944
SH3_Tec_like 346..399 CDD:212702 11/62 (18%)
SH2_Tec_family 403..505 CDD:198188 24/108 (22%)
PTKc_Tec_like 521..778 CDD:173637 107/263 (41%)
Pkinase_Tyr 526..777 CDD:285015 107/257 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468344
Domainoid 1 1.000 165 1.000 Domainoid score I1208
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D17578at33392
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24418
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.