DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and Map3k9

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:XP_017170611.1 Gene:Map3k9 / 338372 MGIID:2449952 Length:1120 Species:Mus musculus


Alignment Length:431 Identity:115/431 - (26%)
Similarity:181/431 - (41%) Gaps:88/431 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   909 DENSDRDIDNDEEEEDSASDDVLSMKDHCYCVPSLAASISLSTNRPLYEEEWFHGVLPREEVVRL 973
            |:.:....:.:|:||::|::    :..|. .:|...|......   ..|:|.   .|...:||.:
Mouse    21 DDATGAGAEEEEDEEEAAAE----LGSHA-ALPYWTAVFEYEA---AGEDEL---TLRLGDVVEV 74

  Fly   974 LNNDGDFLVRETIRNEESQIVLSVCWNGHKHFIVQTTG--EGNFRFEGPPFASIQELIMHQYHSE 1036
            |:.|..      :..:|.      .|.|.   :.|..|  ..|:......|:|            
Mouse    75 LSKDSQ------VSGDEG------WWTGQ---LNQRVGIFPSNYVTPRSAFSS------------ 112

  Fly  1037 LPVTVKSGAILRRPVCR---ERWELSNDDVVLLERIGRGNFGDVYKAKLKSTKLDVAVKTCRMTL 1098
               ..:.||  ..|.|.   :..|:...::.|.|.||.|.||.||:|.....  :||||..|.. 
Mouse   113 ---RCQPGA--EDPSCYPPIQLLEIDFAELTLEEIIGIGGFGKVYRAFWAGD--EVAVKAARHD- 169

  Fly  1099 PDEQKRKFL----QEGRILKQYDHPNIVKLIGICVQKQPIMIVMELVLGGSLLTYLRKNSNGLTT 1159
            |||...:.:    ||.::.....||||:.|.|:|:::..:.:|||...||.|...|  :...:..
Mouse   170 PDEDISQTIENVRQEAKLFAMLKHPNIIALRGVCLKEPNLCLVMEFARGGPLNRVL--SGKRIPP 232

  Fly  1160 RQQMGMCRDAAAGMRYLESK---NCIHRDLAARNCLV-------DLEHSV-KISDFGMSRE--EE 1211
            ...:......|.||.||..:   ..|||||.:.|.|:       ||.:.: ||:|||::||  ..
Mouse   233 DILVNWAVQIARGMNYLHDEAIVPIIHRDLKSSNILILQKVENGDLSNKILKITDFGLAREWHRT 297

  Fly  1212 EYIVSDGMKQIPVKWTAPEALNFGKYTSLCDVWSYGILMWEIFSKGDTPYSGMTNSRARERIDTG 1276
            ..:.:.|    ...|.|||.:....::...||||||:|:||:.: |:.|:.|:      :.:...
Mouse   298 TKMSAAG----TYAWMAPEVIRASMFSKGSDVWSYGVLLWELLT-GEVPFRGI------DGLAVA 351

  Fly  1277 Y-------RMPTPKSTPEEMYRLMLQCWAADAESRPHFDEI 1310
            |       .:|.|.:.||...:||..||..|..|||.|..|
Mouse   352 YGVAMNKLALPIPSTCPEPFAKLMEDCWNPDPHSRPSFTSI 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 15/87 (17%)
TyrKc 1063..1311 CDD:197581 87/272 (32%)
PTKc_Fes_like 1067..1315 CDD:270637 86/268 (32%)
Map3k9XP_017170611.1 SH3_MLK1-3 49..106 CDD:212992 14/77 (18%)
STKc_MLK1 130..399 CDD:271047 88/279 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100013
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.