DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and AgaP_AGAP001259

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:XP_551584.3 Gene:AgaP_AGAP001259 / 3290450 VectorBaseID:AGAP001259 Length:339 Species:Anopheles gambiae


Alignment Length:346 Identity:74/346 - (21%)
Similarity:135/346 - (39%) Gaps:68/346 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   740 QPSQHHHSSGSDCPTNSSSSSSNNNNNNKNTSSNSNHSASQSTIITSTITTTITTTTTTTPSKEN 804
            :|:.|...|      |.::::|:......|........:.:|.:..|....:.:...|..||..:
Mosquito     3 RPTAHPQQS------NVNTTTSDQKRPRSNFMLIVGGLSGKSALPESVPPKSPSAHVTVQPSSPS 61

  Fly   805 SRLKFKVPKIQKKSKAIRNTFRSKLLNFQLKRSKPCKQCTKRRRIHPS-KSVFDFAKEFEVEQPA 868
            |..|....|....||        :.:|.:.:..|..|:..||..||.| :|..|..::.:...|.
Mosquito    62 SNFKLLSGKFAIDSK--------RKINCKTRIYKCIKRILKRNSIHASPQSCKDHQQQQQHHHPR 118

  Fly   869 GSAADEQFCNCPPAGQKPVKPSVQISGHKDHPFESSSGELDENSDRDIDN--------------- 918
            .........:...|..:.:|..:: ..|:|.       |.|.|..:.::.               
Mosquito   119 SHRMPAALRSPNAADYREIKTLLE-KQHRDL-------EYDVNLAKCVEKPAFIKKIAINMLQSA 175

  Fly   919 -DEEEEDSASDDVLSMKDHCYCVPSLAASISLSTN-RPLYEEEWFHGVLPREEVVRLLNN--DGD 979
             ..|:|||..  ||..:.......::.:.:..... |.|.:|.|:|..|||...::||.:  .|.
Mosquito   176 VSNEKEDSTL--VLHREQTATVTGTIQSDLEQEREYRRLLDECWYHENLPRSLSLQLLADKLPGS 238

  Fly   980 FLVRETIRNEESQIVLSVCW---------NGHK---HFIVQTTGEGNFRFEG--PPFASIQELIM 1030
            ||||::....:       |:         :|.:   :.||:|:.|| ::.:|  ..|:|::.||:
Mosquito   239 FLVRKSTTQPD-------CYALSLRVPPGSGPRIAHYLIVRTSTEG-YKIKGFQKEFSSLRALIV 295

  Fly  1031 HQYHSELPVTVKSGAILRRPV 1051
            |  ||.:|..:.....:.|||
Mosquito   296 H--HSVMPEALPVPLAVPRPV 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 30/101 (30%)
TyrKc 1063..1311 CDD:197581
PTKc_Fes_like 1067..1315 CDD:270637
AgaP_AGAP001259XP_551584.3 SH2 217..311 CDD:301589 28/103 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.