DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and hop

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_511119.2 Gene:hop / 32080 FlyBaseID:FBgn0004864 Length:1177 Species:Drosophila melanogaster


Alignment Length:404 Identity:121/404 - (29%)
Similarity:189/404 - (46%) Gaps:88/404 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   965 LPREEVVRLLNNDGDFL-----------VRETI----RNEESQIVLSVCWNGHKHFI-------- 1006
            |.:|:::|..|.||:.|           :.|||    .::|::     .::.|..|.        
  Fly   782 LRQEQLLRQKNLDGNILKMLDQDICPAPIFETIMDGWSDDETK-----RFSHHDIFSRLNTIKAE 841

  Fly  1007 ----------VQTTGEGN----FRFEGP--PFASIQELIMHQYHSELPVTVKSGAILRRPVCRER 1055
                      :.|.|.|:    .|.:.|  ||.....|::      :|:|.:         ||..
  Fly   842 ILPNYMPPPEIATNGTGDETVIDRSDIPFLPFPRSNMLMV------IPLTSE---------CRVI 891

  Fly  1056 WELSNDDVVLLERIGRGNFGDVYKAKLKSTKLD-----VAVKTCRMTLPDEQKRKFLQEGRILKQ 1115
            :.:.|       .||||::|.|||..|:....|     ||:|   |....:....|.:|..|::.
  Fly   892 YNMEN-------MIGRGHYGTVYKGHLEFNDKDQPREQVAIK---MLNTMQVSTDFHREIGIMRT 946

  Fly  1116 YDHPNIVKLIGICVQKQPIMIVMELVLGGSLLTYLRKNSNGLTTRQQMGMCRDAAAGMRYLESKN 1180
            ..|||||| .....:|.. .|:||.:..||...|||..:..|...:.:....|.|.||:||....
  Fly   947 LSHPNIVK-FKYWAEKSH-CIIMEYLQSGSFDIYLRFTAPNLNNPRLVSFALDIANGMKYLSDMG 1009

  Fly  1181 CIHRDLAARNCLVDLEHS-----VKISDFGMSR--EEEEYIVSDGMKQIPVKWTAPEALNFGKYT 1238
            .|||||||||.|||  |:     |||||||:::  ..:.|..:...:.||::|.:|||::..:::
  Fly  1010 LIHRDLAARNILVD--HNGDGDCVKISDFGLAQFANSDGYYYAKSKRDIPIRWYSPEAISTCRFS 1072

  Fly  1239 SLCDVWSYGILMWEIFSKGDTPYSGMTNSRARE---RIDTGYRMPTPKSTPEEMYRLMLQCWAAD 1300
            |..||||||:.::|:||:|:.|......:...:   |:.:|.|:..|.|.|:.:|.||..||.|.
  Fly  1073 SYSDVWSYGVTLFEMFSRGEEPNLVPIQTSQEDFLNRLQSGERLNRPASCPDFIYDLMQLCWHAT 1137

  Fly  1301 AESRPHFDEIYNVV 1314
            ..|||.|..|.:::
  Fly  1138 PRSRPSFATIVDII 1151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 21/112 (19%)
TyrKc 1063..1311 CDD:197581 94/262 (36%)
PTKc_Fes_like 1067..1315 CDD:270637 95/263 (36%)
hopNP_511119.2 B41 39..259 CDD:214604
SH2_Jak_family 420..516 CDD:198177
PTK_Jak_rpt1 584..836 CDD:270633 13/58 (22%)
PTKc_Jak_rpt2 886..1155 CDD:270634 98/289 (34%)
TyrKc 894..1151 CDD:197581 96/270 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.