DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and Map3k20

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:XP_038962299.1 Gene:Map3k20 / 311743 RGDID:1561394 Length:802 Species:Rattus norvegicus


Alignment Length:266 Identity:83/266 - (31%)
Similarity:131/266 - (49%) Gaps:17/266 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly  1057 ELSNDDVVLLERIGRGNFGDVYKAKLKSTKLDVAVKTCRMTLPDEQKRKFLQEGRILKQYDHPNI 1121
            ::..||:...|..|.|:||.||:||..|...:||||         :..|..:|..||....|.|:
  Rat    10 QIKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVK---------KLLKIEKEAEILSVLSHRNV 65

  Fly  1122 VKLIGICVQKQPIMIVMELVLGGSLLTYLRKN-SNGLTTRQQMGMCRDAAAGMRYLESK---NCI 1182
            ::..|:.::.....||.|....|||..|:..| |..:.....|....|.|.||.||..:   ..|
  Rat    66 IQFYGVILEPPNYGIVTEYASLGSLYDYINSNRSEEMDMEHIMTWATDVAKGMHYLHMEAPVKVI 130

  Fly  1183 HRDLAARNCLVDLEHSVKISDFGMSREEEEYIVSDGMKQIPVKWTAPEALNFGKYTSLCDVWSYG 1247
            ||||.:||.::..:..:||.|||.||..........:...|  |.|||.:.....:..||.:|||
  Rat   131 HRDLKSRNVVIAADGVLKICDFGASRFHNHTTHMSLVGTFP--WMAPEVIQSLPVSETCDTYSYG 193

  Fly  1248 ILMWEIFSKGDTPYSGMTNSR-ARERIDTGYRMPTPKSTPEEMYRLMLQCWAADAESRPHFDEIY 1311
            :::||:.:: :.|:.|:...: |...::...|:..|.|.|.....|:.|||.|||:.||.|.:|.
  Rat   194 VVLWEMLTR-EVPFKGLEGLQVAWLVVEKNERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQII 257

  Fly  1312 NVVDAL 1317
            ::::::
  Rat   258 SILESM 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581 80/252 (32%)
PTKc_Fes_like 1067..1315 CDD:270637 81/252 (32%)
Map3k20XP_038962299.1 STKc_MLTK 22..263 CDD:270962 80/252 (32%)
SAM_MLTK 338..408 CDD:188928
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100013
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.