DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and Map3k11

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_001013168.1 Gene:Map3k11 / 309168 RGDID:1359261 Length:850 Species:Rattus norvegicus


Alignment Length:297 Identity:95/297 - (31%)
Similarity:139/297 - (46%) Gaps:59/297 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1059 SNDDVVLLERIGRGNFGDVYKAKLKSTKLDVAVKTCRMTLPDEQ----KRKFLQEGRILKQYDHP 1119
            |..::.|.|.||.|.||.||:...:...  ||||..|.. |||.    .....||.|:.....||
  Rat   114 SFQELRLEEVIGIGGFGKVYRGSWRGEL--VAVKAARQD-PDEDISVTAESVRQEARLFAMLAHP 175

  Fly  1120 NIVKLIGICVQKQPIMIVMELVLGGSLLTYLRKNSNGLTTRQ-----QMGMCRDAAAGMRYLESK 1179
            ||:.|..:|:::..:.:|||...||.|       |..|..|:     .:......|.||.||   
  Rat   176 NIIALKAVCLEEPNLCLVMEYAAGGPL-------SRALAGRRVPPHVLVNWAVQIARGMHYL--- 230

  Fly  1180 NC------IHRDLAARNCLV-------DLEH-SVKISDFGMSRE--EEEYIVSDGMKQIPVKWTA 1228
            :|      |||||.:.|.|:       |:|| ::||:|||::||  :...:.:.|    ...|.|
  Rat   231 HCEALVPVIHRDLKSNNILLLQPIEGDDMEHKTLKITDFGLAREWHKTTQMSAAG----TYAWMA 291

  Fly  1229 PEALNFGKYTSLCDVWSYGILMWEIFSKGDTPYSGMTNSRARERIDTGY-------RMPTPKSTP 1286
            ||.:....::...||||:|:|:||:.: |:.||.|:      :.:...|       .:|.|.:.|
  Rat   292 PEVIKASTFSKGSDVWSFGVLLWELLT-GEVPYRGI------DCLAVAYGVAVNKLTLPIPSTCP 349

  Fly  1287 EEMYRLMLQCWAADAESRPHFDEIYNVVDAL---ILR 1320
            |...:||..|||.|...||.|..|...::||   :||
  Rat   350 EPFAQLMADCWAQDPHRRPDFASILQQLEALEAQVLR 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581 89/279 (32%)
PTKc_Fes_like 1067..1315 CDD:270637 89/279 (32%)
Map3k11NP_001013168.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..37
SH3_MLK1-3 46..103 CDD:212992
STKc_MLK3 114..380 CDD:271049 91/289 (31%)
STYKc 118..377 CDD:214568 90/282 (32%)
Leucine-zipper 1 404..425
Leucine-zipper 2 439..460
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 536..850
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100013
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.