DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and jak2a

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_571168.1 Gene:jak2a / 30307 ZFINID:ZDB-GENE-980526-481 Length:1095 Species:Danio rerio


Alignment Length:277 Identity:90/277 - (32%)
Similarity:141/277 - (50%) Gaps:25/277 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  1063 VVLLERIGRGNFGDVYKAKL----KSTKLDVAVKTCRMTLPDEQKRKFLQEGRILKQYDHPNIVK 1123
            ::.|:.:|:||||.|.|.:.    .:|...||||..:.:.. |..|.|.:|..||:...|.|||:
Zfish   812 LIFLQLLGKGNFGSVEKCRYDPLQDNTGEVVAVKKLQHSTA-EHLRDFEREIEILRSLQHENIVR 875

  Fly  1124 LIGICVQ--KQPIMIVMELVLGGSLLTYLRKNSNGLTTRQQMGMCRDAAAGMRYLESKNCIHRDL 1186
            ..|:|..  :..:.:|||.:..|||..||.||.......:.:........||.||..|..:||||
Zfish   876 YKGVCYSAGRNNLRLVMEFLPFGSLRDYLSKNRERFDHSKLLLYASQICKGMDYLAEKRYVHRDL 940

  Fly  1187 AARNCLVDLEHSVKISDFGMSR---EEEEYIVSDGMKQIPVKWTAPEALNFGKYTSLCDVWSYGI 1248
            |.||.||:.|..|||.|||:::   :::||.......:.|:.|.|||:|...|::...||||:|:
Zfish   941 ATRNILVESEFRVKIGDFGLTKVLPQDKEYYTVREPGESPIFWYAPESLTESKFSVASDVWSFGV 1005

  Fly  1249 LMWEIFS---KGDTPYSGMTNSRARER------------IDTGYRMPTPKSTPEEMYRLMLQCWA 1298
            :::|:|:   |..:|.:........::            :...||:|.|...|.|::.||.||||
Zfish  1006 VLYELFTYSEKSCSPPAVFMEQMGEDKQGQMIVYHLIDLLKRNYRLPAPDGCPAEIHALMKQCWA 1070

  Fly  1299 ADAESRPHFDEIYNVVD 1315
            .:...||.|.::...|:
Zfish  1071 PEPADRPLFRDLARTVE 1087

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581 89/271 (33%)
PTKc_Fes_like 1067..1315 CDD:270637 88/271 (32%)
jak2aNP_571168.1 B41 20..247 CDD:214604
FERM_C_JAK2 243..352 CDD:270141
SH2_Jak2 352..448 CDD:198242
PKc_like 509..770 CDD:304357
Pkinase_Tyr 509..769 CDD:285015
PTKc_Jak2_rpt2 807..1090 CDD:271107 90/277 (32%)
TyrKc 812..1084 CDD:197581 89/272 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100013
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.