DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and Mst1r

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:XP_038937153.1 Gene:Mst1r / 300999 RGDID:1306465 Length:1418 Species:Rattus norvegicus


Alignment Length:289 Identity:90/289 - (31%)
Similarity:149/289 - (51%) Gaps:39/289 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  1069 IGRGNFGDVYKAKL---KSTKLDVAVKTCRMTLPDEQKRKFLQEGRILKQYDHPNIVKLIGICVQ 1130
            ||:|:||.||..:.   ...::..|:|:.......::...||:||.|::...||||:.||||.:.
  Rat  1078 IGKGHFGVVYHGEYTDEAQNQIHCAIKSLSRITEVQEVEAFLREGLIMRGLHHPNILALIGIMLP 1142

  Fly  1131 KQPI-MIVMELVLGGSLLTYLRKNSN------GLTTRQQMGMCR--------------------- 1167
            .:.: .:::..:..|.||.::|....      |........:||                     
  Rat  1143 PEGLPRVLLPYMRHGDLLRFIRSPQRVSAQCPGWGVSASTHLCRCSPVSSCPQNPTVKDLISFGL 1207

  Fly  1168 DAAAGMRYLESKNCIHRDLAARNCLVDLEHSVKISDFGMSR---EEEEYIVSDGM-KQIPVKWTA 1228
            ..|.||.||..:..:|||||||||::|...:||::|||::|   ::|.|.|.... .::||||.|
  Rat  1208 QVACGMEYLAEQKFVHRDLAARNCMLDESFTVKVADFGLARGILDKEYYSVRQHRHARLPVKWMA 1272

  Fly  1229 PEALNFGKYTSLCDVWSYGILMWEIFSKGDTPYSGMTNSRARERIDTGYRMPTPKSTPEEMYRLM 1293
            .|:|...::|:..||||:|:|:||:.::|..||..:........:..|.|:|.|:..|:.:|::|
  Rat  1273 LESLQTYRFTTKSDVWSFGVLLWELLTRGAPPYPHIDPFDLSHFLVQGRRLPQPEYCPDSLYQVM 1337

  Fly  1294 LQCWAADAESRPHFD----EIYNVVDALI 1318
            |:||.||..:||.|.    |:..|..:|:
  Rat  1338 LRCWEADPAARPTFRALVLEVEQVASSLL 1366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581 88/280 (31%)
PTKc_Fes_like 1067..1315 CDD:270637 89/284 (31%)
Mst1rXP_038937153.1 Sema_RON 29..521 CDD:200540
PSI 524..566 CDD:396154
IPT 567..681 CDD:417750
IPT_plexin_repeat2 682..766 CDD:238584
IPT 767..>828 CDD:214657
PKc_like 1076..1364 CDD:419665 89/285 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100013
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.