DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and Pik3r2

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:XP_038950364.1 Gene:Pik3r2 / 29741 RGDID:68341 Length:741 Species:Rattus norvegicus


Alignment Length:732 Identity:125/732 - (17%)
Similarity:227/732 - (31%) Gaps:246/732 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   488 LGSLSVIRDG---NGPSPARYEPI-----TNHRLRQAASVHYLGEEIATSSTNPPDLTRL----R 540
            ||.:::.|.|   .||.|....|:     :.|.|..      |.|:.:.....||.|.:|    .
  Rat    78 LGPVALARPGPRPRGPRPLPARPLDGPSESGHTLAS------LAEQFSPPEPAPPILVKLIEAIE 136

  Fly   541 RTQCSMLCLGEDEEPVVLASPAPLTQLTAAVLTNTNNNHIYADLELDKKKD-------TSPSPEC 598
            :.:....|....|      .|||.|..:.:.|...:...:|     |..|.       ...:||.
  Rat   137 QAELDSECYSRPE------LPAPRTDWSLSDLEQWDRTTLY-----DAVKGFLLALPAAVVTPEA 190

  Fly   599 KGEQIQPKKEQI----------RIEINQTAPQNSIDAHLDRIDELNRVLDDRLKRTLQPSDDVNA 653
            ..|..:..:|..          .:.::|......:..||.|:          .:|...|:..|:|
  Rat   191 ASEAYRAMREVTGPVGLVLEPPTLPLHQALTLQFLLQHLGRV----------ARRAPSPATAVHA 245

  Fly   654 IESAEENHIQTRKLAKDPDSQTKRSSSSSSECRSSKDTSHSKKRSLSFSQKSISNIFSNLKEFSK 718
            :.||    .....|...|.........:...|.|...|.....||            ....:|..
  Rat   246 LASA----FGPLLLRAPPPGGEGDGPHTWRSCHSQALTPLLAPRS------------EPAPDFPV 294

  Fly   719 SPLVRMGKNHILNEEQDA---------KRTQPSQHHHSSGSDCPT-------------------- 754
            ..|.|:.:.|:  :|||.         .:.:|:....::|...|:                    
  Rat   295 LLLERLVQEHV--DEQDTAPPALPPKPSKVKPAPTALANGGSTPSLQDAEWYWGDISREEVNERL 357

  Fly   755 -----------NSSSS-------SSNNNNNNK--NTSSNSNHSASQSTIITSTITTTIT----TT 795
                       ::||.       :.....|||  .......|......:...::...|:    .:
  Rat   358 RDTPDGTFLVRDASSKIQGEYTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVELISHYRHES 422

  Fly   796 TTTTPSKENSRLKFKVPKIQK--------------KSKAIRNTFRSKLLNF-------------- 832
            .....:|.::||.:.|.|.|:              :.|.....::.|...:              
  Rat   423 LAQYNAKLDTRLLYPVSKYQQDQVVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQEL 487

  Fly   833 QLKRS----------------KPCKQCTK------RR----------------------RIHPSK 853
            |:||:                :..::|:|      ||                      .||.|:
  Rat   488 QMKRTAIEAFNETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESR 552

  Fly   854 SVFDFAKEFEVEQPAGSAADEQFCNCPPAGQKPVKPS-VQISGHKDHPF----ESSSGELDENSD 913
            :..:  ::...:.......|::        ...:||. :|:...:|...    :..:.:...|..
  Rat   553 TKLE--QDLRAQASDNREIDKR--------MNSLKPDLMQLRKIRDQYLVWLTQKGARQRKINEW 607

  Fly   914 RDIDNDEEEEDSASDDVLSMKDHCYCVPSLAASISLSTNRPLYEEEWFHGVLPREEVVRLLN--N 976
            ..|.|:.|::.|..:|..::..|                   .|..|:.|.:.|.:...:|:  .
  Rat   608 LGIKNETEDQYSLMEDEDALPHH-------------------EERTWYVGKINRTQAEEMLSGKR 653

  Fly   977 DGDFLVRETIRNEESQIVLSVCWNGH-KHFIVQTTGEGNFRFEGP--PFASIQELIMHQYHSEL- 1037
            ||.||:||:  ::......||..:|. ||.::..|..| |.|..|  .:.|::||::|..|:.| 
  Rat   654 DGTFLIRES--SQRGCYACSVVVDGDTKHCVIYRTATG-FGFAEPYNLYGSLKELVLHYQHASLV 715

  Fly  1038 ----PVTVKSGAILRRP 1050
                .:||.....:|.|
  Rat   716 QHNDALTVTLAHPVRAP 732

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 27/95 (28%)
TyrKc 1063..1311 CDD:197581
PTKc_Fes_like 1067..1315 CDD:270637
Pik3r2XP_038950364.1 SH3_PI3K_p85beta 7..80 CDD:212842 1/1 (100%)
RhoGAP 110..321 CDD:413382 45/255 (18%)
SH2_nSH2_p85_like 337..445 CDD:198195 13/107 (12%)
iSH2_PIK3R2 450..610 CDD:214019 18/169 (11%)
SH2_cSH2_p85_like 628..730 CDD:198184 30/123 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.