DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and Srms

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_001011961.1 Gene:Srms / 296472 RGDID:1306602 Length:507 Species:Rattus norvegicus


Alignment Length:487 Identity:149/487 - (30%)
Similarity:232/487 - (47%) Gaps:62/487 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   881 PAGQKPVKPSVQISGHKDHPFESSSGELDENS-------------DRDIDNDEEEEDSASDDVLS 932
            |||:.. :...:|.|..|:|.......::..|             |......||...|..|.:.:
  Rat    32 PAGESE-EDIPRIQGQDDNPVPEQPAAVEPCSFPAPRARLFRALYDFTARCAEELSVSRGDRLYA 95

  Fly   933 MKDHCYCV--------PSL----AASISLSTNRPLYEEEWFHGVLPREEVVRLL----NNDGDFL 981
            :|:....:        ||.    ...::.:|.....::.|:...:.|.:..:||    |..|.||
  Rat    96 LKEEGEYIFAQRLSGPPSTGLVPVTYLAKATPETPSDQPWYFNGISRTQAQQLLLSPANAPGAFL 160

  Fly   982 VRETIRNEESQI---------VLSVCWNGHKHFIVQTTGEGNFRFEGPPFASIQELIMHQYHSE- 1036
            :|.:    ||.|         ...||   |....:..:| |.:..||..|.|:..|:.: |.:. 
  Rat   161 IRPS----ESSIGGYSLSVRAQAKVC---HYRICMAPSG-GLYLQEGRLFPSLDALLAY-YKTNW 216

  Fly  1037 --LPVTVKSGAILRRPVCRERWELSNDDVVLLERIGRGNFGDVYKAK-LKSTKLDV-AVKTCRMT 1097
              :...:....:.:.|:.::.||....:.||..::|.|.||:|::.. |.||.:.| .:|:..|.
  Rat   217 KLIQNPLLQPCVPQMPLAQDEWERPRSEFVLRRKLGEGFFGEVWEGLWLGSTPVAVKVIKSADMK 281

  Fly  1098 LPDEQKRKFLQEGRILKQYDHPNIVKLIGICVQKQPIMIVMELVLGGSLLTYL-RKNSNGLTTRQ 1161
            |.|..|     |...||...|..:::|..||...:|:.||.||:..|:|..|| ......|:...
  Rat   282 LADLTK-----EIEALKSLRHERLIRLHAICSLGEPVYIVTELMGKGNLQVYLGSPEGKALSLPH 341

  Fly  1162 QMGMCRDAAAGMRYLESKNCIHRDLAARNCLVDLEHSVKISDFGMSR--EEEEYIVSDGMKQIPV 1224
            .:|.....|.||.|||.:..:||||||||.||..:.:.|::|||::|  :::.|..|.|.| |||
  Rat   342 LLGFACQVAEGMSYLEERRVVHRDLAARNVLVGDDLTCKVADFGLARLLKDDVYSPSSGSK-IPV 405

  Fly  1225 KWTAPEALNFGKYTSLCDVWSYGILMWEIFSKGDTPYSGMTNSRARERIDTGYRMPTPKSTPEEM 1289
            |||||||.|:..::...||||:|||::|:|:.|..||.||||....::|..|||:|.|...|.|:
  Rat   406 KWTAPEAANYRVFSQKSDVWSFGILLYEVFTYGQCPYEGMTNHETLQQISRGYRLPRPAVCPAEV 470

  Fly  1290 YRLMLQCWAADAESRPHFDEIYNVVDALILRL 1321
            |.||::||....|.||.|..:...::|:..||
  Rat   471 YMLMVECWKGSPEERPTFATLREKLNAINRRL 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 23/101 (23%)
TyrKc 1063..1311 CDD:197581 103/252 (41%)
PTKc_Fes_like 1067..1315 CDD:270637 101/252 (40%)
SrmsNP_001011961.1 SH3 70..124 CDD:302595 8/53 (15%)
SH2 134..212 CDD:301589 22/86 (26%)
PTKc_Srm_Brk 238..498 CDD:133248 105/265 (40%)
Pkinase_Tyr 245..495 CDD:285015 103/255 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.