DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and GRB2

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_002077.1 Gene:GRB2 / 2885 HGNCID:4566 Length:217 Species:Homo sapiens


Alignment Length:93 Identity:31/93 - (33%)
Similarity:44/93 - (47%) Gaps:7/93 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   960 WFHGVLPR---EEVVRLLNNDGDFLVRETIRNEESQIVLSVCW-NGHKHFIVQTTGEGNFRFEGP 1020
            ||.|.:||   ||::....:||.||:||: .:......|||.: |..:||.|...|.|.:.....
Human    60 WFFGKIPRAKAEEMLSKQRHDGAFLIRES-ESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVV 123

  Fly  1021 PFASIQELIMHQYHSELPVTVKSGAILR 1048
            .|.|:.||:  .||....|:......||
Human   124 KFNSLNELV--DYHRSTSVSRNQQIFLR 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 28/82 (34%)
TyrKc 1063..1311 CDD:197581
PTKc_Fes_like 1067..1315 CDD:270637
GRB2NP_002077.1 SH3_GRB2_N 1..56 CDD:212879
SH2_Grb2_like 56..150 CDD:199828 31/93 (33%)
SH3_GRB2_C 160..212 CDD:212882
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.