DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FER and Map3k10

DIOPT Version :9

Sequence 1:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster
Sequence 2:XP_017177776.1 Gene:Map3k10 / 269881 MGIID:1346879 Length:991 Species:Mus musculus


Alignment Length:301 Identity:91/301 - (30%)
Similarity:136/301 - (45%) Gaps:64/301 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  1057 ELSNDDVVLLERIGRGNFGDVYKAKLKSTKLDVAVKTCRM------TLPDEQKRKFLQEGRILKQ 1115
            |:...::.|.|.||.|.||.||:|..:..  :||||..|:      .:..||.|   ||.|:...
Mouse    92 EIPFHELQLEEIIGVGGFGKVYRAVWRGE--EVAVKAARLDPERDPAVTAEQVR---QEARLFGA 151

  Fly  1116 YDHPNIVKLIGICVQKQPIMIVMELVLGGSLLTYLRKNSNGLTTRQ-----QMGMCRDAAAGMRY 1175
            ..||||:.|.|.|:....:.:|||...||:|       |..|..|:     .:......|.||.|
Mouse   152 LQHPNIIALRGACLSPPNLCLVMEYARGGAL-------SRVLAGRRVPPHVLVNWAVQVARGMNY 209

  Fly  1176 LESK---NCIHRDLAARNCLVDLE----HS-----VKISDFGMSRE--EEEYIVSDGMKQIPVKW 1226
            |.:.   ..|||||.:.|.|: ||    |:     :||:|||::||  :...:.:.|    ...|
Mouse   210 LHNDAPVPIIHRDLKSINILI-LEAIENHNLADTVLKITDFGLAREWHKTTKMSAAG----TYAW 269

  Fly  1227 TAPEALNFGKYTSLCDVWSYGILMWEIFSKGDTPYSGMTNSRARERIDTGY-------RMPTPKS 1284
            .|||.:....::...||||:|:|:||:.: |:.||      |..:.:...|       .:|.|.:
Mouse   270 MAPEVIRLSLFSKSSDVWSFGVLLWELLT-GEVPY------REIDALAVAYGVAMNKLTLPIPST 327

  Fly  1285 TPEEMYRLM--------LQCWAADAESRPHFDEIYNVVDAL 1317
            .||...||:        .:||..|...||.|..|...::.:
Mouse   328 CPEPFARLLEGEPGPCGEECWDPDPHGRPDFGSILKQLEVI 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224
TyrKc 1063..1311 CDD:197581 89/287 (31%)
PTKc_Fes_like 1067..1315 CDD:270637 89/287 (31%)
Map3k10XP_017177776.1 SH3_MLK1-3 20..76 CDD:212992
PKc_like 103..368 CDD:389743 88/288 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100013
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.